Comparing GFF3155 FitnessBrowser__psRCH2:GFF3155 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
52% identity, 99% coverage: 4:697/698 of query aligns to 5:713/714 of Q8ZND6
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
45% identity, 45% coverage: 379:693/698 of query aligns to 11:334/339 of 6ioxA
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
44% identity, 46% coverage: 375:696/698 of query aligns to 3:330/332 of 2af3C
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
44% identity, 46% coverage: 375:696/698 of query aligns to 4:331/333 of P38503
Sites not aligning to the query:
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
44% identity, 44% coverage: 389:693/698 of query aligns to 20:324/325 of 1xcoD
6zngF Maeb full-length acetyl-coa bound state (see paper)
35% identity, 44% coverage: 389:693/698 of query aligns to 439:743/753 of 6zngF
Sites not aligning to the query:
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
30% identity, 46% coverage: 375:696/698 of query aligns to 430:757/759 of P76558
Sites not aligning to the query:
7t85A Crystal structure of the n-terminal domain of the phosphate acetyltransferase from escherichia coli
39% identity, 27% coverage: 4:194/698 of query aligns to 5:173/173 of 7t85A
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
28% identity, 20% coverage: 533:675/698 of query aligns to 127:266/285 of 3uf6A
Sites not aligning to the query:
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
28% identity, 20% coverage: 533:675/698 of query aligns to 129:268/288 of 3u9eB
Sites not aligning to the query:
>GFF3155 FitnessBrowser__psRCH2:GFF3155
MHTIFLAPTGFGGGLNSISLGLIRALENAGLKVGFFKPIAQPFPVDQGRERSCILVERTL
KLTSPEPLPLEQVERQLADGEIDLLLEDVVSRYQQVAAGKDVVIVEGMVPTRESNYTQRI
NTQLAKSLDAEVILIAAQGNDSLKRLAERIEIQAQLYGGAKDPKVLGVILNKVKTEEGLP
AFIDSLKQHLPLLGSADFQLLGAIPFSEELNALRTRDIAELLGAQVLNAGEADQRRVNKI
VLCARAVPNTVQLLQSGVLVVTPGDRDDIILAASLASLNGEKLAGLLLCSDFAPDPRILE
LCKAALDGGLPVMTVETNSYDTANNLFGLNKETPADDIERATRVTDFIAKHLHPEFLHTR
CSVPRGELRMSPAAFRYQLVKRAQDANKRIVLPEGNEPRTIRAAAICQERGIARCVLLAK
PEEVQQVAREQGISLPASLEILDPDSIANRYVEPMCEMRKAKGLTPEDAREQLKDTVVLG
TMMLALDEVDGLVSGAVHTTANTIRPALQLIKTAPGYSLVSSVFFMLLPDQVLVYGDCAV
NPNPSATELAEIALQSAESAVALGVNPRVAMISYSTGSSGSGAEVEKVAEATRIAQERAP
ALPIDGPLQYDAASVLSVGKQKAPNSKVAGQATVFIFPDLNTGNTTYKAVQRNANCLSVG
PMLQGLAKPVNDLSRGALVDDIVFTIALTALQAANQKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory