SitesBLAST
Comparing GFF3160 FitnessBrowser__WCS417:GFF3160 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P60844 Aquaporin Z; Bacterial nodulin-like intrinsic protein; Water channel AqpZ from Escherichia coli (strain K12) (see paper)
64% identity, 91% coverage: 1:229/251 of query aligns to 1:231/231 of P60844
- C9 (≠ F9) mutation to S: No effect.
- C20 (= C20) mutation to S: Loss of oligomerization; no alteration of water permeability.
- T183 (= T181) mutation to C: No effect.
- R189 (= R187) mutation R->V,S: Loss of function.
2o9eA Crystal structure of aqpz mutant t183c complexed with mercury (see paper)
63% identity, 90% coverage: 1:227/251 of query aligns to 3:231/232 of 2o9eA
3nkaA Crystal structure of aqpz h174g,t183f (see paper)
65% identity, 82% coverage: 1:207/251 of query aligns to 3:211/230 of 3nkaA
P08995 Nodulin-26; N-26 from Glycine max (Soybean) (Glycine hispida) (see paper)
40% identity, 90% coverage: 3:229/251 of query aligns to 38:252/271 of P08995
Sites not aligning to the query:
- 262 modified: Phosphoserine; by CPK
P55088 Aquaporin-4; AQP-4; Mercurial-insensitive water channel; MIWC; WCH4 from Mus musculus (Mouse) (see 2 papers)
37% identity, 86% coverage: 3:219/251 of query aligns to 36:247/323 of P55088
- S111 (≠ A77) modified: Phosphoserine; by PKG; mutation to A: Loss of phosphorylation by PKG (in vitro). No effect on location at cell membrane.
Sites not aligning to the query:
- 4 natural variant: G -> R
2evuA Crystal structure of aquaporin aqpm at 2.3a resolution (see paper)
37% identity, 89% coverage: 1:224/251 of query aligns to 4:243/245 of 2evuA
Q9XF58 Aquaporin PIP2-5; Plasma membrane intrinsic protein 2-5; ZmPIP2-5; ZmPIP2;5; ZmPIP2a from Zea mays (Maize) (see paper)
33% identity, 87% coverage: 1:218/251 of query aligns to 35:263/285 of Q9XF58
- G104 (= G60) mutation to W: Loss of water transport.
P47863 Aquaporin-4; AQP-4; Mercurial-insensitive water channel; MIWC; WCH4 from Rattus norvegicus (Rat) (see 4 papers)
36% identity, 86% coverage: 3:219/251 of query aligns to 36:247/323 of P47863
- S180 (= S153) modified: Phosphoserine; by PKC; mutation to A: Decreases internalization from the cell membrane in response to PKC activation.
- H201 (= H172) mutation to P: Partial loss of transport activity.
Sites not aligning to the query:
- 13 modified: S-palmitoyl cysteine; C→A: Reduced palmitoylation. Loss of palmitoylation; when associated with A-17.
- 17 modified: S-palmitoyl cysteine; C→A: Reduced palmitoylation. Loss of palmitoylation; when associated with A-13.
- 285 modified: Phosphoserine
P61837 Aquaporin PIP1-1; AtPIP1;1; Plasma membrane aquaporin-1; Plasma membrane intrinsic protein 1a; PIP1a from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 85% coverage: 7:219/251 of query aligns to 56:271/286 of P61837
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
Q08733 Aquaporin PIP1-3; AtPIP1;3; Plasma membrane intrinsic protein 1c; PIP1c; Transmembrane protein B; TMP-B from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 85% coverage: 7:219/251 of query aligns to 56:271/286 of Q08733
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
Q06611 Aquaporin PIP1-2; AtPIP1;2; Plasma membrane intrinsic protein 1b; PIP1b; Transmembrane protein A; AthH2; TMP-A from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 85% coverage: 7:219/251 of query aligns to 56:271/286 of Q06611
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
P30302 Aquaporin PIP2-3; Plasma membrane intrinsic protein 2-3; AtPIP2;3; Plasma membrane intrinsic protein 2c; PIP2c; RD28-PIP; TMP2C; Water stress-induced tonoplast intrinsic protein; WSI-TIP from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 75% coverage: 33:219/251 of query aligns to 75:262/285 of P30302
- T223 (= T181) mutation to C: Creates some mercury-sensitivity.
P41181 Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct from Homo sapiens (Human) (see 12 papers)
32% identity, 96% coverage: 7:247/251 of query aligns to 15:253/271 of P41181
- G64 (= G59) to R: in NDI2; loss of water channel activity; dbSNP:rs104894326
- G78 (= G73) mutation to A: Does not affect interaction with MIAC; when associated with A-79.
- C79 (≠ R74) mutation to A: Does not affect interaction with MIAC; when associated with A-78.
- S148 (≠ V150) mutation to A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; mutation to D: Retained in the endoplasmic reticulum.
- R187 (= R187) to C: in NDI2; loss of water channel activity; mutant protein does not fold properly; dbSNP:rs104894328
- A190 (≠ G190) to T: in NDI2; mutant protein does not fold properly and is not functional; dbSNP:rs104894341
- V194 (≠ F194) to I: in dbSNP:rs772051028
- S216 (≠ A218) to P: in NDI2; loss of water channel activity; dbSNP:rs104894329
- L217 (= L219) mutation to A: Abolishes interaction with MIAC; when associated with A-221.
- Y221 (vs. gap) mutation to A: Abolishes interaction with MIAC; when associated with A-217.
- S229 (= S223) mutation to A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; mutation to D: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.
- S231 (≠ G225) mutation to A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; mutation to D: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.
- E232 (= E226) mutation to A: Reduces interaction with MIAC.
- T244 (≠ P238) mutation to A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; mutation to E: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.
Sites not aligning to the query:
- 254 R → L: in NDI2; results in the loss of arginine vasopressin-mediated phosphorylation at S-256; R → Q: in NDI2; exerts a dominant-negative effect on wild-type-AQP2 in that it interferes with its trafficking to the apical membrane; is a loss of function instead of a gain of function mutation on dominant nephrogenic diabetes insipidus
- 256 modified: Phosphoserine; by PKA; S→A: Retained in vesicles.; S→D: Expressed in the apical membrane.
- 258 E → K: in NDI2; retained in the Golgi compartment; dbSNP:rs104894332
- 262 P → L: in NDI2; mutant protein folds properly and is functional but is retained in intracellular vesicles; able to assemble into tetramers with wild-type AQP2 that properly localize to the apical membrane; dbSNP:rs104894339; P→A: No effect on expression at the apical cell membrane.
P43287 Aquaporin PIP2-2; Plasma membrane intrinsic protein 2-2; AtPIP2;2; Plasma membrane intrinsic protein 2b; PIP2b; TMP2b from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
35% identity, 75% coverage: 33:219/251 of query aligns to 75:262/285 of P43287
- R194 (vs. gap) mutation to A: Reduced sensitivity to cytosolic acidification. Insensitive to cytosolic acidification; when associated with A-197.
- D195 (≠ S153) mutation to A: Reduced sensitivity to cytosolic acidification. Insensitive to cytosolic acidification; when associated with A-197.
- H197 (≠ A155) mutation to A: Reduced water transport activity. Reduced sensitivity to cytosolic acidification. Insensitive to cytosolic acidification; when associated with A-194 or A-195.; mutation to D: Reduced water transport activity. Insensitive to cytosolic acidification.; mutation to K: Very low water transport activity. Insensitive to cytosolic acidification.
Sites not aligning to the query:
- 3 modified: N6,N6-dimethyllysine; partial
- 264 H→A: No effect.
P55064 Aquaporin-5; AQP-5 from Homo sapiens (Human) (see 2 papers)
35% identity, 98% coverage: 3:248/251 of query aligns to 12:257/265 of P55064
- A38 (≠ L32) to E: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs398123054
- I45 (≠ V39) to S: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs398123055
- N123 (≠ G120) to D: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs398123057
- S156 (≠ P157) mutation to A: No effect on location at the cell membrane.; mutation to E: Increased location at the cell membrane.
- I177 (= I176) to F: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs398123056
- R188 (= R187) to C: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs368292687
P43286 Aquaporin PIP2-1; Plasma membrane intrinsic protein 2-1; AtPIP2;1; Plasma membrane intrinsic protein 2a; PIP2a from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
36% identity, 75% coverage: 33:219/251 of query aligns to 77:264/287 of P43286
Sites not aligning to the query:
- 3 modified: N6,N6-dimethyllysine; partial; K→A: 2-fold decrease in water transport activity.; K→R: No effect.
- 6 E→A: No effect.
- 280 modified: Phosphoserine; S→A: Normal subcellular localization.
- 283 modified: Phosphoserine; S→A: Intracellular reticulation pattern, probably corresponding to the endoplasmic reticulum.; S→D: Normal subcellular localization.
Q39196 Probable aquaporin PIP1-4; Plasma membrane intrinsic protein 1-4; AtPIP1;4; Transmembrane protein C; TMP-C from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 85% coverage: 7:219/251 of query aligns to 57:272/287 of Q39196
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
5dyeD Crystal structure of the full length s156e mutant of human aquaporin 5 (see paper)
36% identity, 96% coverage: 3:244/251 of query aligns to 11:252/253 of 5dyeD
8ct2D Local refinement of aqp1 tetramer (c1; refinement mask included d1 of protein 4.2 and ankyrin-1 ar1-5) in class 2 of erythrocyte ankyrin-1 complex (see paper)
35% identity, 86% coverage: 3:219/251 of query aligns to 10:223/247 of 8ct2D
P56402 Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct from Mus musculus (Mouse) (see 2 papers)
31% identity, 98% coverage: 3:247/251 of query aligns to 11:253/271 of P56402
- T126 (≠ Y119) mutation to M: Does not cause loss of water channel activity, but impairs trafficking from cytoplasmic vesicles to the cell membrane.
Sites not aligning to the query:
- 256 modified: Phosphoserine; S → L: in cph; loss of a phosphorylation site and loss of trafficking to the apical cell membrane; causes aberrant location at the basolateral cell membrane
Query Sequence
>GFF3160 FitnessBrowser__WCS417:GFF3160
MQKRLTAEFIGTFWLTFGGCGSAILAAAFPELGIGFVGVSLAFGLTVLTMAYAVGGISGG
HFNPAVTLGLWAGRRVAAGEVLPYIAAQVAGAIGASAALYLIANGQPDFAIGGFAANGYG
PLSPGLFDMKAALLAECIATFFFLFIIMRVTSSGAVPGFAPIAIGLALTLIHLVLIPVTN
TSVNPARSTGPALFAGGEYLAQLWLFWLAPMVGGVMGALAARSLGERDKSAGPPQPAPPC
DQRRVGRSTPC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory