SitesBLAST
Comparing GFF3163 FitnessBrowser__psRCH2:GFF3163 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
34% identity, 91% coverage: 23:312/319 of query aligns to 17:304/304 of 1wwkA
- active site: S96 (≠ G101), R230 (= R236), D254 (= D260), E259 (= E265), H278 (= H286)
- binding nicotinamide-adenine-dinucleotide: V100 (= V105), G146 (= G157), F147 (≠ H158), G148 (= G159), R149 (≠ E160), I150 (≠ L161), Y168 (≠ G179), D169 (≠ N180), P170 (vs. gap), V201 (≠ C207), P202 (= P208), T207 (= T213), T228 (≠ A234), S229 (≠ A235), D254 (= D260), H278 (= H286), G280 (≠ A288)
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 94% coverage: 10:310/319 of query aligns to 69:368/466 of P87228
- S87 (= S28) modified: Phosphoserine
- S258 (≠ T210) modified: Phosphoserine
2p9eA Crystal structure of g336v mutant of e.Coli phosphoglycerate dehydrogenase (see paper)
34% identity, 94% coverage: 20:319/319 of query aligns to 20:322/406 of 2p9eA
- active site: N104 (≠ G101), R236 (= R236), D260 (= D260), E265 (= E265), H288 (= H286)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G156 (= G159), H157 (≠ E160), I158 (≠ L161), Y176 (≠ G179), D177 (≠ N180), I178 (≠ L181), H206 (= H206), V207 (≠ C207), P208 (= P208), S212 (≠ Q212), A234 (= A234), S235 (≠ A235), R236 (= R236), H288 (= H286), G290 (≠ A288)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
36% identity, 79% coverage: 61:312/319 of query aligns to 60:314/334 of 5aovA
- active site: L100 (≠ G101), R241 (= R236), D265 (= D260), E270 (= E265), H288 (= H286)
- binding glyoxylic acid: Y74 (≠ S75), A75 (= A76), V76 (≠ T77), G77 (= G78), R241 (= R236), H288 (= H286)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ T77), T104 (≠ V105), F158 (≠ H158), G159 (= G159), R160 (≠ E160), I161 (≠ L161), S180 (≠ N180), R181 (≠ L181), A211 (≠ H206), V212 (≠ C207), P213 (= P208), T218 (= T213), I239 (≠ A234), A240 (= A235), R241 (= R236), H288 (= H286), G290 (≠ A288)
Sites not aligning to the query:
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
34% identity, 80% coverage: 57:312/319 of query aligns to 53:320/334 of 3kb6B
- active site: S97 (≠ G101), R231 (= R236), D255 (= D260), E260 (vs. gap), H294 (= H286)
- binding lactic acid: S72 (≠ A76), V73 (≠ T77), G74 (= G78), Y96 (= Y100), R231 (= R236), H294 (= H286)
- binding nicotinamide-adenine-dinucleotide: V73 (≠ T77), Y96 (= Y100), V101 (= V105), G150 (= G159), R151 (≠ E160), I152 (≠ L161), D171 (≠ N180), V172 (≠ L181), P203 (= P208), T229 (≠ A234), A230 (= A235), R231 (= R236), H294 (= H286), A296 (= A288), Y297 (≠ W289)
Sites not aligning to the query:
1psdA The allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase (see paper)
33% identity, 94% coverage: 20:319/319 of query aligns to 18:320/404 of 1psdA
- active site: N102 (≠ G101), R234 (= R236), D258 (= D260), E263 (= E265), H286 (= H286)
- binding nicotinamide-adenine-dinucleotide: N102 (≠ G101), H155 (≠ E160), I156 (≠ L161), D175 (≠ N180), I176 (≠ L181), K179 (≠ R184), H204 (= H206), V205 (≠ C207), P206 (= P208), A232 (= A234), S233 (≠ A235), R234 (= R236), H286 (= H286)
Sites not aligning to the query:
P0A9T0 D-3-phosphoglycerate dehydrogenase; PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 94% coverage: 20:319/319 of query aligns to 24:326/410 of P0A9T0
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ybaA The active form of phosphoglycerate dehydrogenase (see paper)
33% identity, 94% coverage: 20:319/319 of query aligns to 20:322/406 of 1ybaA
- active site: N104 (≠ G101), R236 (= R236), D260 (= D260), E265 (= E265), H288 (= H286)
- binding 2-oxoglutaric acid: R56 (≠ V53), S57 (≠ N54), C79 (≠ A76), I80 (≠ T77)
- binding nicotinamide-adenine-dinucleotide: I80 (≠ T77), F102 (≠ A99), V108 (= V105), G154 (= G157), G156 (= G159), H157 (≠ E160), I158 (≠ L161), Y176 (≠ G179), D177 (≠ N180), I178 (≠ L181), K181 (≠ R184), H206 (= H206), V207 (≠ C207), P208 (= P208), A234 (= A234), S235 (≠ A235), R236 (= R236), H288 (= H286), G290 (≠ A288)
- binding phosphate ion: G81 (= G78), N83 (= N80)
6p2iA Acyclic imino acid reductase (bsp5) in complex with NADPH and d-arg (see paper)
33% identity, 90% coverage: 31:318/319 of query aligns to 28:306/307 of 6p2iA
- binding d-arginine: E51 (≠ N54), T73 (≠ A76), T74 (= T77), S75 (≠ G78), Y97 (= Y100), W277 (= W289)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S98 (≠ G101), V102 (= V105), G149 (= G157), I150 (≠ H158), G151 (= G159), Q152 (≠ E160), I153 (≠ L161), N172 (= N180), K173 (≠ L181), S174 (≠ P182), R176 (= R184), H199 (= H206), I200 (≠ C207), P201 (= P208), T206 (= T213), T227 (≠ A234), C228 (≠ A235), W277 (= W289)
8atiA Human ctbp2(31-364) in complex with rai2 peptide(315-322)
39% identity, 82% coverage: 32:294/319 of query aligns to 28:297/330 of 8atiA
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T77), T102 (≠ V105), G155 (= G157), G157 (= G159), R158 (≠ E160), T159 (≠ L161), D178 (≠ N180), P179 (= P182), Y180 (≠ G183), H210 (= H206), C211 (= C207), N212 (≠ P208), A238 (= A234), R240 (= R236), H289 (= H286), A291 (= A288), W292 (= W289)
- binding : C28 (= C32), E35 (≠ Q40), H37 (≠ V42)
Sites not aligning to the query:
4lcjA Ctbp2 in complex with substrate mtob (see paper)
39% identity, 82% coverage: 32:294/319 of query aligns to 28:297/330 of 4lcjA
- active site: A98 (≠ G101), R240 (= R236), D264 (= D260), E269 (= E265), H289 (= H286)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: Y50 (≠ V53), H51 (≠ N54), I72 (≠ S75), G73 (≠ A76), S74 (≠ T77), G75 (= G78), R240 (= R236), H289 (= H286), W292 (= W289)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T77), T102 (≠ V105), I154 (≠ L156), G155 (= G157), G157 (= G159), R158 (≠ E160), T159 (≠ L161), D178 (≠ N180), Y180 (≠ G183), H210 (= H206), C211 (= C207), N212 (≠ P208), N214 (≠ T210), N217 (≠ T213), A238 (= A234), A239 (= A235), R240 (= R236), H289 (= H286), W292 (= W289)
4lceA Ctbp1 in complex with substrate mtob (see paper)
37% identity, 85% coverage: 23:294/319 of query aligns to 19:297/327 of 4lceA
- active site: S98 (≠ G101), R240 (= R236), D264 (= D260), E269 (= E265), H289 (= H286)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: R71 (≠ V74), G73 (≠ A76), S74 (≠ T77), G75 (= G78), R240 (= R236), H289 (= H286), W292 (= W289)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T77), T102 (≠ V105), G155 (= G157), G157 (= G159), R158 (≠ E160), V159 (≠ L161), Y177 (≠ G179), D178 (≠ N180), P179 (= P182), Y180 (≠ G183), H210 (= H206), C211 (= C207), N214 (≠ T210), N217 (≠ T213), T238 (≠ A234), A239 (= A235), R240 (= R236), W292 (= W289)
1hl3A Ctbp/bars in ternary complex with NAD(h) and pidlskk peptide (see paper)
37% identity, 85% coverage: 23:294/319 of query aligns to 20:298/331 of 1hl3A
- active site: S99 (≠ G101), R241 (= R236), D265 (= D260), E270 (= E265), H290 (= H286)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ V105), G158 (= G159), R159 (≠ E160), V160 (≠ L161), D179 (≠ N180), Y181 (≠ G183), H211 (= H206), C212 (= C207), G213 (≠ P208), N218 (≠ T213), T239 (≠ A234), A240 (= A235), R241 (= R236), D265 (= D260), H290 (= H286)
- binding : V26 (≠ E29), A27 (≠ L30), F28 (≠ V31), C29 (= C32), E36 (≠ Q40), H38 (≠ V42), E39 (= E43)
Sites not aligning to the query:
1hkuA Ctbp/bars: a dual-function protein involved in transcription corepression and golgi membrane fission (see paper)
37% identity, 85% coverage: 23:294/319 of query aligns to 20:298/331 of 1hkuA
- active site: S99 (≠ G101), R241 (= R236), D265 (= D260), E270 (= E265), H290 (= H286)
- binding nicotinamide-adenine-dinucleotide: S75 (≠ T77), T103 (≠ V105), G156 (= G157), G158 (= G159), R159 (≠ E160), V160 (≠ L161), Y178 (≠ G179), D179 (≠ N180), P180 (= P182), Y181 (≠ G183), C212 (= C207), N218 (≠ T213), T239 (≠ A234), A240 (= A235), R241 (= R236), H290 (= H286), W293 (= W289)
Sites not aligning to the query:
6v89A Human ctbp1 (28-375) in complex with amp (see paper)
37% identity, 85% coverage: 23:294/319 of query aligns to 20:298/332 of 6v89A
6cdfA Human ctbp1 (28-378) (see paper)
37% identity, 85% coverage: 23:294/319 of query aligns to 21:299/333 of 6cdfA
- binding 1,4-dihydronicotinamide adenine dinucleotide: T104 (≠ V105), G157 (= G157), R160 (≠ E160), V161 (≠ L161), Y179 (≠ G179), D180 (≠ N180), P181 (= P182), Y182 (≠ G183), H212 (= H206), C213 (= C207), N219 (≠ T213), T240 (≠ A234), A241 (= A235), R242 (= R236), H291 (= H286), W294 (= W289)
4u6sA Ctbp1 in complex with substrate phenylpyruvate (see paper)
37% identity, 87% coverage: 18:294/319 of query aligns to 15:298/328 of 4u6sA
- active site: S99 (≠ G101), R241 (= R236), D265 (= D260), E270 (= E265), H290 (= H286)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ V105), G156 (= G157), G158 (= G159), R159 (≠ E160), V160 (≠ L161), Y178 (≠ G179), D179 (≠ N180), P180 (= P182), Y181 (≠ G183), H211 (= H206), C212 (= C207), G213 (≠ P208), N218 (≠ T213), T239 (≠ A234), A240 (= A235), R241 (= R236), H290 (= H286), W293 (= W289)
- binding 3-phenylpyruvic acid: Y51 (≠ V53), H52 (≠ N54), I73 (≠ S75), G74 (≠ A76), S75 (≠ T77), G76 (= G78), R241 (= R236), W293 (= W289)
Sites not aligning to the query:
4u6qA Ctbp1 bound to inhibitor 2-(hydroxyimino)-3-phenylpropanoic acid (see paper)
37% identity, 87% coverage: 18:294/319 of query aligns to 15:298/328 of 4u6qA
- active site: S99 (≠ G101), R241 (= R236), D265 (= D260), E270 (= E265), H290 (= H286)
- binding (2E)-2-(hydroxyimino)-3-phenylpropanoic acid: Y51 (≠ V53), I73 (≠ S75), G74 (≠ A76), S75 (≠ T77), G76 (= G78), R241 (= R236), H290 (= H286), W293 (= W289)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S75 (≠ T77), T103 (≠ V105), G156 (= G157), R159 (≠ E160), V160 (≠ L161), Y178 (≠ G179), D179 (≠ N180), P180 (= P182), Y181 (≠ G183), H211 (= H206), C212 (= C207), G213 (≠ P208), N218 (≠ T213), T239 (≠ A234), A240 (= A235), R241 (= R236), H290 (= H286), W293 (= W289)
Sites not aligning to the query:
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
32% identity, 94% coverage: 19:318/319 of query aligns to 14:315/533 of O43175
- T78 (= T77) binding
- R135 (≠ E134) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ EL 160:161) binding
- D175 (≠ N180) binding
- T207 (≠ C207) binding
- CAR 234:236 (≠ AAR 234:236) binding
- D260 (= D260) binding
- V261 (= V261) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HSAW 286:289) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
7dkmA Phgdh covalently linked to oridonin (see paper)
32% identity, 89% coverage: 20:303/319 of query aligns to 11:296/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (= T77), A102 (≠ V105), G148 (= G157), R151 (≠ E160), I152 (≠ L161), Y170 (≠ G179), D171 (≠ N180), P172 (≠ L181), I173 (≠ P182), H202 (= H206), T203 (≠ C207), P204 (= P208), T209 (= T213), C230 (≠ A234), A231 (= A235), R232 (= R236), H279 (= H286), G281 (≠ A288)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: C14 (vs. gap), K17 (vs. gap), I18 (vs. gap), E293 (≠ A300)
Query Sequence
>GFF3163 FitnessBrowser__psRCH2:GFF3163
MSNRAVFLDLSPLEQGDLDLDPLRNAFSELVCHEQSTTDQIVERLQGAQVAIVNKVSLTA
ETLAACPELKLILVSATGVNNIDLQAARERGIVVSNCQAYGTPTVAQHTLMLLLALATRL
PDYQAAVARGRWQESGQFCLLDFPIVELEGKTLGLLGHGELGSAVARLAEAFGMRVLVGN
LPGRPKRPERLDLDELLPQVDALTLHCPLTEQTRNLIGARELQLMKPTAFLINAARGGLV
DEQALADALRRGHLGGAATDVLTSEPPRDDNPLLAPDLPRLIITPHSAWGSREARQRIVA
QLAENATAFFAGAPLRQVN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory