Comparing GFF3170 FitnessBrowser__Phaeo:GFF3170 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ojkA Structure of co-substituted homoprotocatechuate 2,3-dioxygenase in complex with 4-nitrocatechol at 1.68 ang resolution (see paper)
43% identity, 97% coverage: 3:319/327 of query aligns to 2:318/355 of 3ojkA
3ojjA Structure of co-substituted homoprotocatechuate 2,3-dioxygenase from b.Fuscum at 1.72 ang resolution (see paper)
43% identity, 97% coverage: 3:319/327 of query aligns to 2:318/355 of 3ojjA
1f1uA Crystal structure of homoprotocatechuate 2,3-dioxygenase from arthrobacter globiformis (native, low temperature) (see paper)
44% identity, 93% coverage: 3:307/327 of query aligns to 4:308/322 of 1f1uA
1f1vA Anaerobic substrate complex of homoprotocatechuate 2,3-dioxygenase from arthrobacter globiformis. (Complex with 3,4- dihydroxyphenylacetate) (see paper)
44% identity, 93% coverage: 3:307/327 of query aligns to 2:306/320 of 1f1vA
3bzaA Structure of mn-substituted homoprotocatechuate 2,3-dioxygenase from b.Fuscum at 1.7 ang resolution (see paper)
43% identity, 97% coverage: 3:319/327 of query aligns to 2:318/359 of 3bzaA
2igaC Structure of homoprotocatechuate 2,3-dioxygenase from b. Fuscum in complex with reactive intermediates formed via in crystallo reaction with 4-nitrocatechol at low oxygen concentrations. (see paper)
43% identity, 97% coverage: 3:319/327 of query aligns to 2:318/359 of 2igaC
2igaB Structure of homoprotocatechuate 2,3-dioxygenase from b. Fuscum in complex with reactive intermediates formed via in crystallo reaction with 4-nitrocatechol at low oxygen concentrations. (see paper)
43% identity, 97% coverage: 3:319/327 of query aligns to 2:318/359 of 2igaB
2igaA Structure of homoprotocatechuate 2,3-dioxygenase from b. Fuscum in complex with reactive intermediates formed via in crystallo reaction with 4-nitrocatechol at low oxygen concentrations. (see paper)
43% identity, 97% coverage: 3:319/327 of query aligns to 2:318/359 of 2igaA
2ig9B Structure of a full-length homoprotocatechuate 2,3-dioxygenase from b. Fuscum in a new spacegroup. (see paper)
43% identity, 97% coverage: 3:319/327 of query aligns to 2:318/359 of 2ig9B
3eckC Structure of e323l homoprotocatechuate 2,3-dioxygenase from brevibacterium fuscum in complex with putative o-o bond cleavage intermediate formed via in crystallo reaction with 4-sulfonyl catechol at low oxygen concentrations (see paper)
43% identity, 97% coverage: 3:319/327 of query aligns to 2:318/359 of 3eckC
1q0cA Anerobic substrate complex of homoprotocatechuate 2,3-dioxygenase from brevibacterium fuscum. (Complex with 3,4-dihydroxyphenylacetate) (see paper)
43% identity, 97% coverage: 3:319/327 of query aligns to 2:318/319 of 1q0cA
1f1xA Crystal structure of homoprotocatechuate 2,3-dioxygenase from brevibacterium fuscum (see paper)
43% identity, 97% coverage: 3:319/327 of query aligns to 2:318/319 of 1f1xA
4ghcC Structure of y257f variant of homoprotocatechuate 2,3-dioxygenase from b.Fuscum at 1.55 ang resolution (see paper)
43% identity, 97% coverage: 3:319/327 of query aligns to 4:320/361 of 4ghcC
4z6rC Structure of h200e variant of homoprotocatechuate 2,3-dioxygenase from b.Fuscum in complex with 4-sulfonyl catechol at 1.70 ang resolution (see paper)
43% identity, 97% coverage: 3:319/327 of query aligns to 2:318/354 of 4z6rC
3hq0B Crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas in complex with a product (see paper)
26% identity, 83% coverage: 13:283/327 of query aligns to 4:283/288 of 3hq0B
3hpyA Crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas in the complex with 4-methylcatechol (see paper)
26% identity, 83% coverage: 13:283/327 of query aligns to 4:283/288 of 3hpyA
3hpvA Crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas sp. Kl28 (see paper)
26% identity, 83% coverage: 13:283/327 of query aligns to 4:283/297 of 3hpvA
1mpyA Structure of catechol 2,3-dioxygenase (metapyrocatechase) from pseudomonas putida mt-2 (see paper)
29% identity, 83% coverage: 13:283/327 of query aligns to 4:282/307 of 1mpyA
7q2aB Crystal structure of aphc in complex with 4-ethylcatechol (see paper)
27% identity, 91% coverage: 12:307/327 of query aligns to 4:311/352 of 7q2aB
Sites not aligning to the query:
3lm4A Crystal structure of 2,3-dihydroxy biphenyl dioxygenase from rhodococcus sp. (Strain rha1)
27% identity, 91% coverage: 12:307/327 of query aligns to 4:311/325 of 3lm4A
>GFF3170 FitnessBrowser__Phaeo:GFF3170
MPVPAPNLYPDFNTIRLSHVCLNVKDLAASQKFYAEILGLRVSDADENRIYLRAMEERGH
HCVILQQSDQPGTVEVMGFKTFDEEDLDRADAYFRKKGRPTEWVQRPYQGRTLLTSDNMG
IPLEFYHKMDRLEPIHQQYALYRGVKPLRIDHFNCFSHDVDASVAFYSDFGFRVTEYTED
EDSKKLWAAWLHRKGGVHDMAFTNGTGPRMHHVAFWVPNPLNIIDLLDLMATTGYVTNIE
RGPGRHGISNAFFLYILDPDGHRIEIYCSDYQTVDPDLEPIKWDLKDPQRQTLWGAPAPE
SWFKHGSRFVGVTPKESELQASPIIAP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory