SitesBLAST
Comparing GFF3178 FitnessBrowser__psRCH2:GFF3178 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q55415 Bicarbonate transporter BicA from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
30% identity, 95% coverage: 21:570/576 of query aligns to 10:549/564 of Q55415
- T69 (= T80) binding ; mutation to A: Alters bicarbonate transport.
- D258 (≠ E288) binding ; mutation D->A,E: Alters bicarbonate transport.
- T262 (≠ C292) binding ; mutation to A: Alters bicarbonate transport.
- G300 (≠ A330) binding
- A301 (= A331) binding
- T302 (≠ I332) binding ; mutation to A: Alters bicarbonate transport.
- A471 (≠ V492) mutation to N: Alters bicarbonate transport.
- L476 (≠ I497) mutation to S: Alters bicarbonate transport.
- A486 (= A507) mutation to E: Alters bicarbonate transport.
- L490 (= L511) mutation to Q: Alters bicarbonate transport.
5da0A Structure of the the slc26 transporter slc26dg in complex with a nanobody (see paper)
29% identity, 88% coverage: 24:532/576 of query aligns to 9:458/467 of 5da0A
Sites not aligning to the query:
7v75A Thermostabilized human prestin in complex with salicylate (see paper)
29% identity, 94% coverage: 23:561/576 of query aligns to 23:600/605 of 7v75A
7v74A Thermostabilized human prestin in complex with sulfate (see paper)
28% identity, 94% coverage: 23:561/576 of query aligns to 23:592/597 of 7v74A
7lhvA Structure of arabidopsis thaliana sulfate transporter atsultr4;1 (see paper)
27% identity, 97% coverage: 6:565/576 of query aligns to 10:575/575 of 7lhvA
- binding 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine: L126 (= L116), R127 (= R117), W130 (≠ R120)
- binding (2S,3R,4E)-2-amino-3-hydroxyoctadec-4-en-1-yl dihydrogen phosphate: L128 (≠ A118), L131 (= L121), E409 (≠ V420), L413 (vs. gap), G417 (= G426), A421 (= A430)
- binding sulfate ion: A84 (= A81), S321 (≠ A331), F322 (≠ I332)
6ki1B The transmembrane domain of a cyanobacterium bicarbonate transporter bica (see paper)
31% identity, 70% coverage: 21:424/576 of query aligns to 9:392/392 of 6ki1B
7xujA Human slc26a3 in complex with uk5099
25% identity, 83% coverage: 8:485/576 of query aligns to 54:532/703 of 7xujA
- binding (E)-2-cyano-3-(1-phenylindol-3-yl)prop-2-enoic acid: V79 (≠ I36), Q83 (≠ L40), E271 (≠ G210), S376 (≠ A333), R377 (= R334), V380 (≠ T337), L421 (= L378), A422 (≠ L379), N425 (≠ V382)
- binding cholesterol hemisuccinate: F171 (≠ L113), V311 (≠ Y268), Q315 (≠ R272)
7xulA Human slc26a3 in complex with tenidap
25% identity, 83% coverage: 8:485/576 of query aligns to 47:523/690 of 7xulA
- binding 5-chloranyl-2-oxidanyl-3-thiophen-2-ylcarbonyl-indole-1-carboxamide: V72 (≠ I36), L75 (≠ P39), Q76 (≠ L40), E262 (≠ G210), S367 (≠ A333), L412 (= L378), N416 (≠ V382)
- binding cholesterol hemisuccinate: I157 (≠ L108), F162 (≠ L113), P209 (≠ Q164), K214 (vs. gap), Y217 (vs. gap), V302 (≠ Y268), Q306 (≠ R272), V309 (≠ L275), V450 (= V420)
7xuhA Down-regulated in adenoma in complex with tqr1122
24% identity, 83% coverage: 8:485/576 of query aligns to 54:536/707 of 7xuhA
- binding 2-[4,8-dimethyl-2-oxidanylidene-7-[[3-(trifluoromethyl)phenyl]methoxy]chromen-3-yl]ethanoic acid: P124 (≠ A81), I125 (≠ A82), L187 (≠ I125), I192 (≠ T130), F195 (= F133), V335 (≠ E288), S338 (≠ L291), S380 (≠ A333), M433 (= M386)
- binding cholesterol hemisuccinate: V223 (= V165), F226 (≠ L168), K227 (vs. gap), Y230 (vs. gap), F318 (= F271), Q319 (≠ R272)
Q9URY8 Probable sulfate permease C869.05c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 63% coverage: 17:380/576 of query aligns to 115:480/840 of Q9URY8
Sites not aligning to the query:
- 823 modified: Phosphoserine
P40879 Chloride anion exchanger; Down-regulated in adenoma; Protein DRA; Solute carrier family 26 member 3 from Homo sapiens (Human) (see 3 papers)
25% identity, 83% coverage: 8:485/576 of query aligns to 61:554/764 of P40879
- N153 (≠ Q92) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N161 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N165 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- C307 (≠ A225) to W: in dbSNP:rs34407351
Sites not aligning to the query:
- 761:764 PDZ-binding; mutation Missing: Loss of interaction with NHERF4. No effect on localization to cell membrane or its exchanger activity.
Q8CIW6 Solute carrier family 26 member 6; Anion exchange transporter; Chloride-formate exchanger; Pendrin-L1; Pendrin-like protein 1; Putative anion transporter-1; Pat-1 from Mus musculus (Mouse) (see paper)
24% identity, 79% coverage: 33:485/576 of query aligns to 102:564/758 of Q8CIW6
- F552 (= F473) mutation to A: Does not inhibit formate transport in PMA-induced cells.
P58735 Sulfate anion transporter 1; SAT-1; Solute carrier family 26 member 1 from Mus musculus (Mouse) (see paper)
24% identity, 90% coverage: 23:543/576 of query aligns to 69:667/704 of P58735
- T190 (= T103) mutation to M: Decreased sulfate-hydrogencarbonate exchange activity. Loss of localization to plasma membrane.
- S363 (≠ L291) mutation to L: Decreased sulfate-hydrogencarbonate exchange activity. Increased accumulation of protein in ER.
Sites not aligning to the query:
- 56 A→T: Decreased sulfate-hydrogencarbonate exchange activity. Does not affect localization to plasma membrane.
Q62273 Sulfate transporter; Diastrophic dysplasia protein homolog; ST-OB; Solute carrier family 26 member 2 from Mus musculus (Mouse) (see paper)
21% identity, 94% coverage: 21:559/576 of query aligns to 106:715/739 of Q62273
- F368 (≠ A251) mutation to A: Reduced sulfate-chloride exchange activity.
- E417 (= E309) mutation E->A,K: Loss of sulfate-chloride exchange activity.
Q9BXS9 Solute carrier family 26 member 6; Anion exchange transporter; Pendrin-like protein 1; Pendrin-L1 from Homo sapiens (Human) (see 3 papers)
24% identity, 79% coverage: 33:485/576 of query aligns to 100:563/759 of Q9BXS9
- N167 (vs. gap) modified: carbohydrate, N-linked (GlcNAc) asparagine; mutation to Q: Reduced chloride oxalate exchanger activity.
- N172 (vs. gap) modified: carbohydrate, N-linked (GlcNAc) asparagine; mutation to Q: Reduced chloride oxalate exchanger activity.
- V206 (≠ L121) to M: in dbSNP:rs13324142
- ATV 547:549 (≠ -PL 470:471) mutation to NVN: Does not inhibit cell membrane localization. Inhibits interaction with CA2 and bicarbonate transport.
- N553 (≠ A475) mutation to A: Does not inhibit interaction with CA2. Inhibits interaction with CA2 and bicarbonate transport in PMA-induced cells.
Sites not aligning to the query:
- 582 S→A: Does not inhibit interaction with CA2. Does not inhibit interaction with CA2 and bicarbonate transport in PMA-induced cells.
8sieC Pendrin in complex with bicarbonate
21% identity, 90% coverage: 23:542/576 of query aligns to 44:588/613 of 8sieC
- binding Lauryl Maltose Neopentyl Glycol: G198 (≠ E163), S296 (≠ R272), T300 (≠ A276), F303 (= F279)
- binding bicarbonate ion: Y65 (≠ L44), F101 (vs. gap), L356 (≠ I332), S357 (≠ A333), V403 (≠ L379), N406 (≠ V382)
- binding cholesterol: L226 (vs. gap), V255 (≠ A213), I262 (≠ V220), Y272 (≠ T239), F411 (vs. gap), V414 (≠ A389), V414 (≠ A389), C415 (≠ P390), C415 (≠ P390), I436 (= I412), M452 (≠ L428), F453 (≠ L429)
- binding 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine: W421 (≠ L396), V429 (= V404), V432 (≠ L407), F433 (≠ L408), I436 (= I412)
8shcC Pendrin in complex with niflumic acid
21% identity, 90% coverage: 23:542/576 of query aligns to 44:588/613 of 8shcC
- binding cholesterol: I199 (≠ Q164), A223 (≠ V182), V255 (≠ A213), Y272 (≠ T239), M412 (≠ S387), C415 (≠ P390), M452 (≠ L428), F453 (≠ L429)
- binding 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine: Q156 (≠ R117), W421 (≠ L396), V432 (≠ L407), F433 (≠ L408), F455 (≠ A431)
- binding 2-{[3-(trifluoromethyl)phenyl]amino}nicotinic acid: Y65 (≠ L44), F101 (vs. gap), T173 (= T134), E252 (≠ G210), I312 (≠ E288), L356 (≠ I332), S357 (≠ A333), V402 (≠ L378), N406 (≠ V382)
8sgwC Pendrin in complex with chloride
21% identity, 90% coverage: 23:542/576 of query aligns to 44:588/613 of 8sgwC
- binding Lauryl Maltose Neopentyl Glycol: G198 (≠ E163), S296 (≠ R272), T300 (≠ A276), F303 (= F279)
- binding cholesterol: I228 (vs. gap), V255 (≠ A213), I262 (≠ V220), Y272 (≠ T239), K408 (≠ W384), F411 (vs. gap), M412 (≠ S387), M412 (≠ S387), V414 (≠ A389), C415 (≠ P390), V417 (= V392), I439 (≠ V415)
- binding 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine: F159 (≠ R120), Y163 (≠ F124), F284 (≠ A251), P286 (= P253), I289 (≠ G261), F343 (≠ V319), F346 (≠ L322), W421 (≠ L396), F433 (≠ L408), I436 (= I412), F455 (≠ A431), F464 (vs. gap), P465 (vs. gap)
7lguA Structure of human prestin in the presence of nacl (see paper)
21% identity, 90% coverage: 25:540/576 of query aligns to 70:644/680 of 7lguA
Q9JKQ2 Prestin; Solute carrier family 26 member 5 from Meriones unguiculatus (Mongolian jird) (Gerbillus unguiculatus) (see 2 papers)
22% identity, 80% coverage: 25:485/576 of query aligns to 82:558/744 of Q9JKQ2
- 158:168 (vs. 88:96, 18% identical) Involved in motor function
- S398 (≠ A333) mutation to E: Removes salicylate competition with anions. Retains the displacement currents.
- R399 (= R334) mutation to E: Removes salicylate competition with anions. Retains the displacement currents.
Query Sequence
>GFF3178 FitnessBrowser__psRCH2:GFF3178
MQLPPLFSAWRQALRLGYGTRALRGDISAGLTVGIIAIPLAMALAIAVGVAPQHGLYTVL
VAAPLIALTGGSRFNVSGPTAAFVVILLPITQQFGLGGLLLCTMLAGLILITLGLLRAGR
LIAFIPYPVTLGFTAGIGIVIATLQIKDLFGLTLTEQPQHYVEQVSLLLRSLPGAQLGDA
VVAAICLAVLIIWPRWVPKVPGHLVALTVGALAGLLLESVGLSVATLGERFSYTLDGVTH
PGIPPFLPDFAWPWLLPGPDGQPLQLSYELFRQLLAPAFAIAMLGAIESLLCAVVADGMT
GSNHEPNGELIGQGLGNLVAPLFGGITATAAIARSATNVRAGAFSPLASMIHAGVVLVAI
LWLAPLFSYLPMAALAALLVMVAWNMSEAPHVVHVLRIAPRSDVLVLLTCLILTVLFDMV
LAVGVGLLLAAGLFIKRMSELTDTTALSRDQRRLLQDMPEHVATYAIRGPLFFGAAEKAL
GALRRFNPEVKVVIVDISAVPMLDMTALAALENVLVDYRRLGVTLILSGSNARVRLKLRR
AGIHRLQGHLLYVRDLSQAREKALRLLRPEPGAATG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory