Comparing GFF3179 FitnessBrowser__Phaeo:GFF3179 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
47% identity, 96% coverage: 13:441/448 of query aligns to 10:441/449 of 5lh9D
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
47% identity, 96% coverage: 13:441/448 of query aligns to 8:439/447 of 5lhaA
6s54A Transaminase from pseudomonas fluorescens (see paper)
45% identity, 99% coverage: 6:448/448 of query aligns to 7:451/453 of 6s54A
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
37% identity, 97% coverage: 1:433/448 of query aligns to 1:439/459 of 5kquC
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
36% identity, 100% coverage: 1:448/448 of query aligns to 3:456/460 of 5kr6B
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
37% identity, 96% coverage: 17:448/448 of query aligns to 16:445/450 of 6gwiB
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
37% identity, 96% coverage: 17:446/448 of query aligns to 18:444/448 of 6io1B
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
37% identity, 93% coverage: 17:434/448 of query aligns to 18:439/458 of 5kr3A
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
35% identity, 97% coverage: 7:441/448 of query aligns to 3:431/443 of 6fyqA
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
38% identity, 93% coverage: 31:448/448 of query aligns to 2:417/422 of 7qx3A
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
36% identity, 93% coverage: 17:434/448 of query aligns to 15:438/455 of 5kr5A
Sites not aligning to the query:
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
37% identity, 96% coverage: 17:448/448 of query aligns to 15:438/443 of 7qx0B
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
35% identity, 94% coverage: 17:438/448 of query aligns to 15:434/453 of 6s4gA
7q9xAAA Probable aminotransferase
35% identity, 94% coverage: 17:438/448 of query aligns to 16:435/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
35% identity, 94% coverage: 17:438/448 of query aligns to 16:435/455 of 4a6tC
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
35% identity, 91% coverage: 31:438/448 of query aligns to 2:407/427 of 4ba5A
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
35% identity, 91% coverage: 31:438/448 of query aligns to 1:403/423 of 4a6rA
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
35% identity, 93% coverage: 31:445/448 of query aligns to 31:444/454 of 7ypmA
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
35% identity, 96% coverage: 7:434/448 of query aligns to 3:431/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
35% identity, 96% coverage: 7:434/448 of query aligns to 3:431/451 of 6g4eA
>GFF3179 FitnessBrowser__Phaeo:GFF3179
MTESNFLKEHNGRLMWHPMTSPQDSVAQPPKIITGAEGVFITDIDGHRVIDGVGGLWNVN
LGYSCQPVKDAMAAQLDKLPYYSTFRGTSNDAAIELSYELSRFFEPDGLSRAFFTSGGSD
SVETALRLARQYHKLRGDSGRTKFLSLKKGYHGTHIGGASVNGNANFRTAYEPLLPGCFH
IPAPYTYRNPFDESDPERLAQLCAAALEDEIAFQGANTIAAMIMEPILGAGGVIPPHPSF
APMVQEICNRNGILLITDEVITAYGRTGAWSGARLWGIQPDMMCTAKAITNGYFPFGAVM
LGARMIEVFEDNPDAKIGHGYTYSGHPVGAAAALTCLAEMQRLNVTATAAARGAQLYEGC
LALKERFDVIGDVRGGYGLMIALELVSDRQTRAPLDGRRALALQEACYEAGALIRVSGPN
VILSPPLIMSEADTRGLLDALRVGLCAT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory