SitesBLAST
Comparing GFF3209 FitnessBrowser__Phaeo:GFF3209 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 93% coverage: 17:265/269 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 93% coverage: 17:265/269 of query aligns to 4:253/254 of 1g6hA
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
33% identity, 88% coverage: 17:254/269 of query aligns to 2:227/253 of 6z5uK
- binding phosphoaminophosphonic acid-adenylate ester: R12 (≠ F27), S37 (≠ N52), G38 (= G53), G40 (= G55), K41 (= K56), T42 (≠ S57), T43 (≠ S58), Q86 (= Q99), E164 (= E191), H197 (= H224)
- binding magnesium ion: Q86 (= Q99), E164 (= E191)
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
33% identity, 88% coverage: 17:254/269 of query aligns to 4:229/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
33% identity, 88% coverage: 17:254/269 of query aligns to 4:229/263 of 7d08B
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
28% identity, 93% coverage: 17:265/269 of query aligns to 2:235/240 of 6mjpA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
35% identity, 88% coverage: 17:253/269 of query aligns to 2:223/241 of 4u00A
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
30% identity, 88% coverage: 18:255/269 of query aligns to 4:223/369 of P19566
- L86 (= L103) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P192) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (≠ N197) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
31% identity, 88% coverage: 18:255/269 of query aligns to 3:222/374 of 2awnB
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
31% identity, 88% coverage: 18:255/269 of query aligns to 4:223/371 of P68187
- A85 (= A102) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (= K122) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V146) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ I149) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ D151) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ Q156) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G169) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D190) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
31% identity, 88% coverage: 18:255/269 of query aligns to 3:222/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F27), S37 (≠ N52), G38 (= G53), C39 (≠ A54), G40 (= G55), K41 (= K56), S42 (= S57), T43 (≠ S58), Q81 (= Q99), R128 (≠ T161), A132 (≠ R165), S134 (≠ P167), G136 (= G169), Q137 (≠ L170), E158 (= E191), H191 (= H224)
- binding magnesium ion: S42 (= S57), Q81 (= Q99)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
31% identity, 88% coverage: 18:255/269 of query aligns to 3:222/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F27), G38 (= G53), C39 (≠ A54), G40 (= G55), K41 (= K56), S42 (= S57), T43 (≠ S58), R128 (≠ T161), S134 (≠ P167), Q137 (≠ L170)
- binding beryllium trifluoride ion: S37 (≠ N52), G38 (= G53), K41 (= K56), Q81 (= Q99), S134 (≠ P167), G136 (= G169), H191 (= H224)
- binding magnesium ion: S42 (= S57), Q81 (= Q99)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
31% identity, 88% coverage: 18:255/269 of query aligns to 3:222/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F27), V17 (≠ A32), G38 (= G53), C39 (≠ A54), G40 (= G55), K41 (= K56), S42 (= S57), T43 (≠ S58), R128 (≠ T161), A132 (≠ R165), S134 (≠ P167), Q137 (≠ L170)
- binding tetrafluoroaluminate ion: S37 (≠ N52), G38 (= G53), K41 (= K56), Q81 (= Q99), S134 (≠ P167), G135 (≠ Y168), G136 (= G169), E158 (= E191), H191 (= H224)
- binding magnesium ion: S42 (= S57), Q81 (= Q99)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
31% identity, 88% coverage: 18:255/269 of query aligns to 3:222/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F27), V17 (≠ A32), G38 (= G53), C39 (≠ A54), G40 (= G55), K41 (= K56), S42 (= S57), T43 (≠ S58), R128 (≠ T161), A132 (≠ R165), S134 (≠ P167), Q137 (≠ L170)
- binding magnesium ion: S42 (= S57), Q81 (= Q99)
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
31% identity, 88% coverage: 18:255/269 of query aligns to 1:220/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F27), S35 (≠ N52), G36 (= G53), C37 (≠ A54), G38 (= G55), K39 (= K56), S40 (= S57), T41 (≠ S58), R126 (≠ T161), A130 (≠ R165), S132 (≠ P167), G134 (= G169), Q135 (≠ L170)
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
30% identity, 93% coverage: 17:265/269 of query aligns to 2:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
30% identity, 93% coverage: 17:265/269 of query aligns to 2:235/238 of 6s8gA
- binding phosphoaminophosphonic acid-adenylate ester: Y12 (≠ F27), R15 (≠ V30), N37 (= N52), G40 (= G55), K41 (= K56), T42 (≠ S57), T43 (≠ S58), Q84 (= Q99), S136 (≠ R165), S138 (≠ P167), E141 (≠ L170)
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
30% identity, 93% coverage: 17:265/269 of query aligns to 2:235/235 of 6mhzA
- binding adp orthovanadate: Y12 (≠ F27), N37 (= N52), G38 (= G53), G40 (= G55), K41 (= K56), T42 (≠ S57), T43 (≠ S58), Q84 (= Q99), S136 (≠ R165), S138 (≠ P167), G139 (≠ Y168), G140 (= G169), E162 (= E191), G166 (= G195), H194 (= H224)
6mbnA Lptb e163q in complex with atp (see paper)
30% identity, 93% coverage: 17:265/269 of query aligns to 3:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
30% identity, 92% coverage: 17:264/269 of query aligns to 2:234/234 of 6b89A
- binding adenosine-5'-diphosphate: Y12 (≠ F27), R15 (≠ V30), V17 (≠ A32), N37 (= N52), G38 (= G53), G40 (= G55), K41 (= K56), T42 (≠ S57), T43 (≠ S58)
- binding magnesium ion: T42 (≠ S57), Q84 (= Q99)
- binding novobiocin: L71 (≠ Y87), H72 (≠ E88), P83 (≠ F98), A86 (≠ I101), S87 (≠ A102), F89 (= F104), R90 (≠ D105), R91 (≠ G106), L92 (≠ M107), V101 (≠ I125), Q135 (≠ A164), R149 (= R178)
Query Sequence
>GFF3209 FitnessBrowser__Phaeo:GFF3209
MEDGYITEDGRKIGGVVMEMKNITLRFGGVVAIKDISFDIREGEIRAIIGPNGAGKSSML
NVISGFYVPQEGEVLFRGKPRPQMRPYEVARQGIARTFQNIALFDGMSVLDNVMTGRLNF
MKTNIFQQAIWRGKAEAEETENREAVERIIDFLEIQAIRKTPVARLPYGLKKRVELARAL
AAEPKLLLLDEPMAGMNVEEKEDMSRFILDVNDEFGTTIALIEHDMGVVMDLSDRVVVMD
YGKKIGDGTPDEVRNNQDVIDAYLGVSHD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory