Comparing GFF3213 FitnessBrowser__psRCH2:GFF3213 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4qq7A Crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione
40% identity, 96% coverage: 10:205/205 of query aligns to 6:203/204 of 4qq7A
4hojA Crystal structure of glutathione transferase homolog from neisseria gonorrhoeae, target efi-501841, with bound glutathione
39% identity, 97% coverage: 7:205/205 of query aligns to 1:196/197 of 4hojA
6wegD Structure of ft (mgla-sspa)-ppgpp-pigr peptide complex (see paper)
30% identity, 88% coverage: 17:196/205 of query aligns to 14:192/194 of 6wegD
6wmtS F. Tularensis rnaps70-(mgla-sspa)-ppgpp-pigr-igla DNA complex (see paper)
30% identity, 88% coverage: 17:196/205 of query aligns to 13:191/202 of 6wmtS
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
29% identity, 87% coverage: 18:196/205 of query aligns to 14:199/212 of 2cz2A
Sites not aligning to the query:
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
29% identity, 87% coverage: 18:196/205 of query aligns to 17:202/216 of Q9WVL0
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
29% identity, 87% coverage: 18:196/205 of query aligns to 17:202/216 of O43708
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
29% identity, 87% coverage: 18:196/205 of query aligns to 13:198/208 of 1fw1A
Sites not aligning to the query:
4is0A Structural insights into omega-class glutathione transferases: a snapshot of enzyme reduction and identification of the non-catalytic ligandin site. (see paper)
25% identity, 73% coverage: 17:166/205 of query aligns to 31:181/238 of 4is0A
Sites not aligning to the query:
3vlnA Human glutathione transferase o1-1 c32s mutant in complex with ascorbic acid (see paper)
26% identity, 77% coverage: 10:166/205 of query aligns to 25:182/239 of 3vlnA
4yqvA Glutathione s-transferase omega 1 bound to covalent inhibitor c4-10 (see paper)
25% identity, 73% coverage: 17:166/205 of query aligns to 30:180/237 of 4yqvA
Sites not aligning to the query:
4yqmA Glutathione s-transferase omega 1 bound to covalent inhibitor c1-27 (see paper)
25% identity, 73% coverage: 17:166/205 of query aligns to 30:180/237 of 4yqmA
Sites not aligning to the query:
1eemA Glutathione transferase from homo sapiens (see paper)
25% identity, 73% coverage: 17:166/205 of query aligns to 30:180/237 of 1eemA
Sites not aligning to the query:
6pnoA Human gsto1-1 complexed with 2-chloro-n-(4-chloro-3-(n- isopropylsulfamoyl)phenyl)acetamide (see paper)
25% identity, 73% coverage: 17:166/205 of query aligns to 32:182/239 of 6pnoA
Sites not aligning to the query:
6pnmA Human gsto1-1 complexed with 2-chloro-n-(4-chloro-3- (morpholinosulfonyl)phenyl)acetamide (see paper)
25% identity, 73% coverage: 17:166/205 of query aligns to 32:182/239 of 6pnmA
Sites not aligning to the query:
5v3qA Human gsto1-1 complexed with ml175 (see paper)
25% identity, 73% coverage: 17:166/205 of query aligns to 32:182/239 of 5v3qA
Sites not aligning to the query:
5uehA Structure of gsto1 covalently conjugated to quinolinic acid fluorosulfate (see paper)
25% identity, 73% coverage: 17:166/205 of query aligns to 32:182/239 of 5uehA
Sites not aligning to the query:
6pnnA Human gsto1-1 complexed with 2-chloro-n-(4-chloro-3-(n-(2- methoxyethyl)-n-methylsulfamoyl)phenyl)acetamide (see paper)
25% identity, 73% coverage: 17:166/205 of query aligns to 31:181/238 of 6pnnA
Sites not aligning to the query:
6mhdA Glutathione s-transferase omega 1 bound to covalent inhibitor 44 (see paper)
25% identity, 73% coverage: 17:166/205 of query aligns to 37:187/244 of 6mhdA
Sites not aligning to the query:
6mhcA Glutathione s-transferase omega 1 bound to covalent inhibitor 37 (see paper)
25% identity, 73% coverage: 17:166/205 of query aligns to 37:187/244 of 6mhcA
Sites not aligning to the query:
>GFF3213 FitnessBrowser__psRCH2:GFF3213
MATTNRLGCYSDPADHYSHRVRLVLAEKGVSVDILDVEAGQCPVKLAEVNPYATVPTLVD
RDLALYEPGVILEYLEERYPHPPLLPVYPVARANTRLLMHRIQRDWCSLADRILDQRTAE
TGRVQARKELRESLTGVSPIFAEKAYFMSDEMSLVDCCLLPILWRLPRLGIELPRAAKPL
LDYMERNFAREAFQASLSTVERSMR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory