Comparing GFF3215 FitnessBrowser__Marino:GFF3215 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
P45131 Homoserine O-acetyltransferase; HAT; Homoserine O-trans-acetylase; Homoserine transacetylase; HTA; EC 2.3.1.31 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
26% identity, 90% coverage: 11:317/343 of query aligns to 9:339/358 of P45131
Sites not aligning to the query:
2vavB Crystal structure of deacetylcephalosporin c acetyltransferase (dac- soak) (see paper)
24% identity, 87% coverage: 18:315/343 of query aligns to 21:329/350 of 2vavB
Sites not aligning to the query:
2vatA Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a (see paper)
24% identity, 87% coverage: 18:315/343 of query aligns to 20:327/347 of 2vatA
Sites not aligning to the query:
5w8oB Homoserine transacetylase metx from mycobacterium hassiacum (see paper)
25% identity, 89% coverage: 12:315/343 of query aligns to 5:324/346 of 5w8oB
6puxA Homoserine transacetylase metx from mycobacterium tuberculosis (see paper)
26% identity, 89% coverage: 12:315/343 of query aligns to 15:344/366 of 6puxA
7rytB Crystal structure of mycobacterium tuberculosis acetylated homoserine transacetylase with coenzyme a (see paper)
26% identity, 89% coverage: 12:315/343 of query aligns to 14:343/368 of 7rytB
Sites not aligning to the query:
8f2lA Crystal structure of mycobacterium tuberculosis homoserine transacetylase in complex with l-homoserine (see paper)
26% identity, 89% coverage: 12:315/343 of query aligns to 14:343/367 of 8f2lA
6iohA Crystal structure of homoserine o-acetyltransferase in complex with homoserine from mycobacterium smegmatis atcc 19420 (see paper)
28% identity, 52% coverage: 14:193/343 of query aligns to 17:215/375 of 6iohA
Sites not aligning to the query:
6ioiA Crystal structure of homoserine o-acetyltransferase in complex with coa from mycobacterium smegmatis atcc 19420 (see paper)
28% identity, 52% coverage: 14:193/343 of query aligns to 17:215/366 of 6ioiA
Sites not aligning to the query:
Q6FEQ3 Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
25% identity, 80% coverage: 68:342/343 of query aligns to 87:376/387 of Q6FEQ3
D2Z028 L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 from Streptomyces lavendulae (see paper)
27% identity, 50% coverage: 18:188/343 of query aligns to 20:204/374 of D2Z028
Q10341 Serine O-succinyltransferase; SST; EC 2.3.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 55% coverage: 21:208/343 of query aligns to 95:297/504 of Q10341
Sites not aligning to the query:
>GFF3215 FitnessBrowser__Marino:GFF3215
MASKQWLVEDYEAGDLPLTSGETLHSARLRYHRIGELNAPKDNLIMLPTYYGGAAAGNHP
WVRGNSPLDPDRYCIVIPALLGAGESSSPSNTAGAQGGPGFPSVSLYDNVMLQKRLVEDI
FGDARIALVMGWSMGGMQALQWGCLFPTQVRAVLATCCTARCYPHNRVFLEGVKAALTCD
HAFENGRYRTPPELGLRAFGRVYAGWAYSQAFFRHELWREQGFGSIEELLRFWEQDHLGQ
DANDLLTVLNTWQNGDISDNPVFGMDYEAALSAIAMPTRMMPCTTDLYFTEEDASEDGRR
MPGATVESLESDWGHVAGGAGREAQSHNRILAAARALLSGKAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory