Comparing GFF3224 FitnessBrowser__Phaeo:GFF3224 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 82% coverage: 27:256/282 of query aligns to 12:246/265 of P07821
8sx8A Bovine multidrug resistance protein 4 (mrp4) bound to prostaglandin e1 in msp lipid nanodisc (see paper)
34% identity, 75% coverage: 38:248/282 of query aligns to 388:587/1175 of 8sx8A
Sites not aligning to the query:
8sx7A Bovine multidrug resistance protein 4 (mrp4) bound to dhea-s in msp lipid nanodisc (see paper)
34% identity, 75% coverage: 38:248/282 of query aligns to 401:600/1188 of 8sx7A
Sites not aligning to the query:
8swnA Bovine multidrug resistance protein 4 (mrp4) e1202q mutant bound to atp in msp lipid nanodisc (see paper)
36% identity, 65% coverage: 38:219/282 of query aligns to 366:536/1135 of 8swnA
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
37% identity, 76% coverage: 27:240/282 of query aligns to 5:222/280 of 5x40A
O65934 ABC transporter ATP-binding/permease protein Rv1747; EC 7.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
33% identity, 82% coverage: 3:232/282 of query aligns to 295:525/865 of O65934
Sites not aligning to the query:
8j3wA Cryo-em structure of aspirin-bound abcc4
35% identity, 64% coverage: 38:217/282 of query aligns to 416:585/1218 of 8j3wA
Sites not aligning to the query:
8i4cA Cryo-em structure of u46619-bound abcc4
35% identity, 64% coverage: 38:217/282 of query aligns to 416:585/1218 of 8i4cA
Sites not aligning to the query:
8i4aA Cryo-em structure of dipyridamole-bound abcc4
35% identity, 64% coverage: 38:217/282 of query aligns to 416:585/1218 of 8i4aA
Sites not aligning to the query:
8bwrA Cryo-em structure of nanodisc-reconstituted wildtype human mrp4 (in complex with prostaglandin e2) (see paper)
35% identity, 64% coverage: 38:217/282 of query aligns to 410:579/1195 of 8bwrA
Sites not aligning to the query:
8bwqA Cryo-em structure of nanodisc-reconstituted wildtype human mrp4 (in complex with topotecan) (see paper)
35% identity, 64% coverage: 38:217/282 of query aligns to 410:579/1195 of 8bwqA
Sites not aligning to the query:
8bwpA Cryo-em structure of nanodisc-reconstituted wildtype human mrp4 (in complex with methotrexate) (see paper)
35% identity, 64% coverage: 38:217/282 of query aligns to 410:579/1195 of 8bwpA
Sites not aligning to the query:
8bwoA Cryo-em structure of nanodisc-reconstituted human mrp4 with e1202q mutation (outward-facing occluded conformation) (see paper)
35% identity, 64% coverage: 38:217/282 of query aligns to 407:576/1211 of 8bwoA
Sites not aligning to the query:
8bjfA Cryo-em structure of nanodisc-reconstituted wildtype human mrp4 (inward-facing conformation) (see paper)
35% identity, 64% coverage: 38:217/282 of query aligns to 410:579/1195 of 8bjfA
Sites not aligning to the query:
O15439 ATP-binding cassette sub-family C member 4; MRP/cMOAT-related ABC transporter; Multi-specific organic anion transporter B; MOAT-B; Multidrug resistance-associated protein 4; EC 7.6.2.-; EC 7.6.2.2; EC 7.6.2.3 from Homo sapiens (Human) (see 5 papers)
35% identity, 64% coverage: 38:217/282 of query aligns to 424:593/1325 of O15439
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
34% identity, 68% coverage: 27:219/282 of query aligns to 2:206/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
33% identity, 68% coverage: 27:219/282 of query aligns to 2:206/230 of 1l2tA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
34% identity, 78% coverage: 29:247/282 of query aligns to 5:225/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 73% coverage: 35:239/282 of query aligns to 10:216/240 of 4ymuJ
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
33% identity, 67% coverage: 38:225/282 of query aligns to 19:211/280 of Q5M244
>GFF3224 FitnessBrowser__Phaeo:GFF3224
MAVELARENGAPAGSTESCQHLEQSPLGIRGLTVTYGEKPAVFSVDMTVEPGRMTAIIGP
NGAGKSTLLKAALGIVPPVSGRVQVFGKPLNSQRGRIAYVPQRASVDWDFPTRVIDVVMM
GLYRELGLLGRITGRHRAAAKACLDRVGMGDFATRQIGQLSGGQQQRVFLARALAQGADL
YLLDEPFAGVDAATEKAIIAVLKQLRADGKTVVVVHHDLATVGEYFDNVFLINTRKVAEG
PVAQAFTAETLQSAYGGRLATAQVDQLATAPTSRHPQTGGTL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory