SitesBLAST
Comparing GFF3242 FitnessBrowser__WCS417:GFF3242 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
78% identity, 94% coverage: 12:433/451 of query aligns to 4:423/442 of 7p61F
- binding flavin mononucleotide: G61 (= G69), G63 (= G71), K72 (= K80), N90 (= N98), D92 (= D100), G181 (= G189), E182 (= E190), N217 (= N225), N218 (= N226), A399 (= A409), H400 (= H410)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G71), G64 (= G72), A65 (= A73), F67 (= F75), K72 (= K80), L75 (= L83), E95 (= E103), Y178 (= Y186), E183 (= E191), F203 (= F211), R320 (= R330), T323 (= T333)
- binding iron/sulfur cluster: S350 (= S360), C351 (= C361), W353 (≠ F363), C354 (= C364), C357 (= C367), F397 (= F407), C398 (= C408), H400 (= H410)
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
47% identity, 88% coverage: 34:431/451 of query aligns to 28:422/437 of 4hea1
- binding flavin mononucleotide: G63 (= G69), K74 (= K80), N91 (= N98), D93 (= D100), Y179 (= Y186), G182 (= G189), E183 (= E190), N218 (= N225), N219 (= N226), L401 (≠ H410)
- binding iron/sulfur cluster: I180 (= I187), P198 (= P205), S351 (= S360), C352 (= C361), G353 (= G362), K354 (≠ F363), C355 (= C364), C358 (= C367), F398 (= F407), C399 (= C408), L401 (≠ H410)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
47% identity, 88% coverage: 34:431/451 of query aligns to 28:422/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G69), G65 (= G71), N91 (= N98), D93 (= D100), G182 (= G189), E183 (= E190), E184 (= E191), N218 (= N225), N219 (= N226), T222 (= T229), P400 (≠ A409)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G71), G66 (= G72), F69 (= F75), K74 (= K80), F77 (≠ L83), E96 (= E103), Y179 (= Y186), E184 (= E191), K201 (= K208), F204 (= F211), T324 (= T333)
- binding iron/sulfur cluster: S351 (= S360), C352 (= C361), K354 (≠ F363), C355 (= C364), C358 (= C367), F398 (= F407), C399 (= C408), L401 (≠ H410), A402 (= A411)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
47% identity, 88% coverage: 34:431/451 of query aligns to 29:423/438 of Q56222
8e9hF Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
47% identity, 92% coverage: 20:433/451 of query aligns to 5:421/436 of 8e9hF
- binding flavin mononucleotide: G53 (= G69), R54 (= R70), G55 (= G71), A57 (= A73), K64 (= K80), N90 (= N98), D92 (= D100), Y178 (= Y186), G181 (= G189), E182 (= E190), E183 (= E191), N217 (= N225), N218 (= N226), S221 (≠ T229), L398 (≠ H410)
- binding iron/sulfur cluster: P197 (= P205), S349 (= S360), C350 (= C361), G351 (= G362), K352 (≠ F363), C353 (= C364), C356 (= C367), S394 (≠ T406), F395 (= F407), C396 (= C408), L398 (≠ H410), G399 (≠ A411)
- binding zinc ion: C333 (≠ N344), E371 (= E382), H420 (≠ G432)
Sites not aligning to the query:
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
43% identity, 90% coverage: 30:433/451 of query aligns to 15:414/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (≠ N344), C364 (≠ E382), H413 (≠ G432)
- binding flavin mononucleotide: G54 (= G69), G56 (= G71), K65 (= K80), N82 (= N98), D84 (= D100), E85 (= E101), G173 (= G189), E175 (= E191), N210 (= N226), G390 (≠ A409), L391 (≠ H410)
- binding nicotinamide-adenine-dinucleotide: G56 (= G71), G57 (= G72), A58 (= A73), F60 (= F75), K65 (= K80), F68 (≠ L83), E85 (= E101), E175 (= E191), R192 (≠ K208), F195 (= F211), I312 (≠ R330), M313 (= M331), S315 (≠ T333)
- binding iron/sulfur cluster: S342 (= S360), C343 (= C361), G344 (= G362), C346 (= C364), C349 (= C367), S387 (≠ T406), C389 (= C408), L391 (≠ H410), G392 (≠ A411)
Sites not aligning to the query:
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
43% identity, 90% coverage: 30:433/451 of query aligns to 15:414/425 of 7t2rB
Sites not aligning to the query:
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
42% identity, 90% coverage: 29:433/451 of query aligns to 160:559/630 of 8a6tB
- binding flavin mononucleotide: G201 (= G71), N227 (= N98), E230 (= E101), N355 (= N226), G535 (≠ A409), L536 (≠ H410)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E191), R337 (≠ K208), R340 (≠ F211), T341 (≠ P212), N342 (≠ A213), S433 (≠ G306)
- binding iron/sulfur cluster: S487 (= S360), C488 (= C361), G489 (= G362), C491 (= C364), C494 (= C367), C534 (= C408), L536 (≠ H410), G537 (≠ A411)
- binding zinc ion: C471 (≠ N344), H558 (≠ G432)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 564
8oh5B Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
43% identity, 93% coverage: 30:447/451 of query aligns to 114:531/584 of 8oh5B
- binding flavin mononucleotide: R154 (= R70), K164 (= K80), N181 (= N98), F269 (≠ Y186), E273 (= E190), E274 (= E191), I307 (≠ V224), N308 (= N225), N309 (= N226), G489 (≠ A409), L490 (≠ H410)
- binding nicotinamide-adenine-dinucleotide: G155 (= G71), G156 (= G72), F159 (= F75), F163 (≠ V79), E273 (= E190), E274 (= E191), K291 (= K208), F294 (= F211), G413 (= G332)
- binding iron/sulfur cluster: P288 (= P205), C442 (= C361), G443 (= G362), C445 (= C364), C448 (= C367), C488 (= C408), L490 (≠ H410), G491 (≠ A411), I531 (= I447)
- binding zinc ion: C425 (≠ N344), H512 (≠ G432), C518 (≠ A434), C523 (≠ A439)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 10, 41, 45
- binding iron/sulfur cluster: 536, 540, 542, 546, 547, 548, 559, 566, 567, 568, 569, 572
7zm7B Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
43% identity, 84% coverage: 55:431/451 of query aligns to 45:423/456 of 7zm7B
- binding flavin mononucleotide: G59 (= G69), G61 (= G71), K70 (= K80), N91 (= N98), D93 (= D100), G182 (= G189), E183 (= E190), E184 (= E191), A218 (≠ N225), N219 (= N226), A401 (= A409), L402 (≠ H410)
- binding iron/sulfur cluster: P198 (= P205), C354 (= C361), G355 (= G362), Q356 (≠ F363), C357 (= C364), C360 (= C367), T398 (= T406), C400 (= C408), L402 (≠ H410)
7arcF Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
42% identity, 86% coverage: 48:433/451 of query aligns to 40:424/430 of 7arcF
- binding flavin mononucleotide: G61 (= G69), R62 (= R70), K72 (= K80), N90 (= N98), D92 (= D100), E93 (= E101), S94 (≠ M102), Y178 (= Y186), G181 (= G189), E182 (= E190), T217 (≠ N225), N218 (= N226), L401 (≠ H410)
- binding iron/sulfur cluster: S352 (= S360), C353 (= C361), G354 (= G362), Q355 (≠ F363), C356 (= C364), C359 (= C367), T397 (= T406), C399 (= C408), L401 (≠ H410)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
47% identity, 80% coverage: 34:392/451 of query aligns to 29:376/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G69), G65 (= G71), K74 (= K80), N90 (= N98), D92 (= D100), E93 (= E101), G181 (= G189), E182 (= E190), E183 (= E191), V216 (= V224), N217 (= N225), N218 (= N226), T221 (= T229)
- binding nicotinamide-adenine-dinucleotide: G65 (= G71), G66 (= G72), A67 (= A73), F69 (= F75), K74 (= K80), E95 (= E103), Y178 (= Y186), E183 (= E191), K200 (= K208), Y203 (≠ F211)
- binding iron/sulfur cluster: I179 (= I187), P197 (= P205), T344 (≠ S360), C345 (= C361), G346 (= G362), Q347 (≠ F363), C348 (= C364), C351 (= C367)
Sites not aligning to the query:
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
47% identity, 80% coverage: 34:392/451 of query aligns to 31:378/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G69), G67 (= G71), K76 (= K80), N92 (= N98), E95 (= E101), Y180 (= Y186), G183 (= G189), E184 (= E190), V218 (= V224), N219 (= N225), N220 (= N226), T223 (= T229)
- binding iron/sulfur cluster: T346 (≠ S360), C347 (= C361), G348 (= G362), Q349 (≠ F363), C350 (= C364), C353 (= C367)
Sites not aligning to the query:
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
47% identity, 80% coverage: 34:392/451 of query aligns to 30:377/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G69), G66 (= G71), K75 (= K80), N91 (= N98), D93 (= D100), E94 (= E101), G182 (= G189), E183 (= E190), E184 (= E191), V217 (= V224), N218 (= N225), N219 (= N226), T222 (= T229)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G71), G67 (= G72), A68 (= A73), F70 (= F75), K75 (= K80), E94 (= E101), E96 (= E103), Y179 (= Y186), E184 (= E191), Y204 (≠ F211)
- binding iron/sulfur cluster: P198 (= P205), T345 (≠ S360), C346 (= C361), G347 (= G362), Q348 (≠ F363), C349 (= C364), C352 (= C367)
Sites not aligning to the query:
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
47% identity, 80% coverage: 34:392/451 of query aligns to 30:377/419 of 6saqB
- binding flavin mononucleotide: G64 (= G69), G66 (= G71), K75 (= K80), N91 (= N98), D93 (= D100), E94 (= E101), Y179 (= Y186), G182 (= G189), E183 (= E190), N218 (= N225), N219 (= N226), T222 (= T229)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G71), G67 (= G72), A68 (= A73), F70 (= F75), K75 (= K80), E94 (= E101), E96 (= E103), T99 (= T106), E184 (= E191), Y204 (≠ F211), T318 (= T333)
- binding iron/sulfur cluster: P198 (= P205), T345 (≠ S360), C346 (= C361), G347 (= G362), Q348 (≠ F363), C349 (= C364), C352 (= C367)
Sites not aligning to the query:
6zk91 Peripheral domain of open complex i during turnover (see paper)
44% identity, 83% coverage: 56:430/451 of query aligns to 46:419/430 of 6zk91
- binding flavin mononucleotide: G59 (= G69), G61 (= G71), K70 (= K80), N88 (= N98), D90 (= D100), E91 (= E101), G179 (= G189), E180 (= E190), A215 (≠ N225), N216 (= N226), A398 (= A409), L399 (≠ H410)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G61 (= G71), G62 (= G72), A63 (= A73), F65 (= F75), K70 (= K80), E93 (= E103), Y176 (= Y186), E181 (= E191), F201 (= F211), T323 (= T333)
- binding iron/sulfur cluster: I177 (= I187), P195 (= P205), C351 (= C361), G352 (= G362), Q353 (≠ F363), C354 (= C364), C357 (= C367), T395 (= T406), C397 (= C408), L399 (≠ H410)
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
42% identity, 89% coverage: 31:433/451 of query aligns to 128:528/599 of 7q4vB
- binding flavin mononucleotide: G166 (= G69), G168 (= G71), N196 (= N98), D198 (= D100), F284 (≠ Y186), G287 (= G189), E288 (= E190), E289 (= E191), N324 (= N226)
- binding iron/sulfur cluster: C457 (= C361), G458 (= G362), K459 (≠ F363), C460 (= C364), C463 (= C367), C503 (= C408), G506 (≠ A411)
- binding zinc ion: C440 (≠ N344), H527 (≠ G432)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 11, 16, 48, 49, 51, 52
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
- binding zinc ion: 533
5lnk1 Entire ovine respiratory complex i (see paper)
44% identity, 83% coverage: 56:430/451 of query aligns to 48:421/432 of 5lnk1
- binding fe2/s2 (inorganic) cluster: P96 (= P104), G97 (≠ N105)
- binding flavin mononucleotide: G61 (= G69), R62 (= R70), K72 (= K80), N90 (= N98), D92 (= D100), E93 (= E101), G94 (≠ M102), Y178 (= Y186), G181 (= G189), E182 (= E190), V216 (= V224), A217 (≠ N225), N218 (= N226), T221 (= T229), L401 (≠ H410)
- binding iron/sulfur cluster: P197 (= P205), S352 (= S360), C353 (= C361), Q355 (≠ F363), C356 (= C364), C359 (= C367), T397 (= T406), I398 (≠ F407), C399 (= C408)
P25708 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH dehydrogenase flavoprotein 1; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Bos taurus (Bovine) (see paper)
44% identity, 83% coverage: 56:430/451 of query aligns to 74:447/464 of P25708
- C379 (= C361) binding
- C382 (= C364) binding
- C385 (= C367) binding
- C425 (= C408) binding
7dgq8 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (see paper)
44% identity, 83% coverage: 56:430/451 of query aligns to 43:416/427 of 7dgq8
- binding flavin mononucleotide: G58 (= G71), K67 (= K80), N85 (= N98), D87 (= D100), E88 (= E101), G89 (≠ M102), C175 (= C188), G176 (= G189), A212 (≠ N225), N213 (= N226)
- binding iron/sulfur cluster: S347 (= S360), C348 (= C361), G349 (= G362), C351 (= C364), C354 (= C367), C394 (= C408), L396 (≠ H410)
- binding : R121 (≠ Y134), Y132 (≠ T145), Q139 (≠ N152), R143 (≠ E156), Y146 (≠ K159), E147 (≠ A160), F165 (= F178), R168 (≠ T181)
Query Sequence
>GFF3242 FitnessBrowser__WCS417:GFF3242
MTLTSFGPANLIKRSPETHPLTWRLRDDAEPVWLDEYQAKNGYAAARKAFADMAQDDIVQ
TVKDAGLKGRGGAGFPTGVKWGLMPKDESINIRYLLCNADEMEPNTWKDRMLMEQLPHLL
IEGMLISARALKTYRGYIFLRGEYTTAAKHLNRAVEEAKAAGLLGKNILGSGFDFELFVH
TGAGRYICGEETALINSLEGRRANPRSKPPFPAAVGVWGKPTCVNNVETLCNVPAIIADG
VDWYKSLAREGSEDMGTKLMGFSGKVKNPGLWELPFGVTARELFEDYAGGMRDGYTLKAW
QPGGAGTGFLLPEHLDAQMYAGGIGKVGTRMGTGLAMAVDNTVNMVSLLRNMEQFFARES
CGFCTPCRDGLPWSVKLLMALENGEGREGDIETLLGLVGFLGPGKTFCAHAPGAVEPLGS
AIKYFRSEFEAGIAPTSAAVPPLARPIVVGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory