SitesBLAST
Comparing GFF3260 FitnessBrowser__Phaeo:GFF3260 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
42% identity, 100% coverage: 4:815/816 of query aligns to 22:823/824 of Q8GAI3
- W66 (= W48) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (= H49) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
33% identity, 99% coverage: 6:816/816 of query aligns to 4:815/824 of 4pabB
- active site: T53 (≠ A55), E102 (= E104), H226 (= H234), Y255 (= Y259), E536 (≠ D538)
- binding flavin-adenine dinucleotide: I11 (= I13), G12 (= G14), G14 (= G16), C15 (≠ V17), V16 (≠ I18), L35 (= L37), E36 (= E38), K37 (≠ R39), G43 (= G45), S44 (≠ T46), T45 (= T47), H47 (= H49), A48 (= A50), A49 (= A51), G50 (= G52), L51 (= L53), V175 (= V177), A204 (= A212), G205 (= G213), W207 (= W215), H226 (= H234), Y228 (= Y236), G326 (= G325), I328 (≠ E327), F353 (= F352), Y355 (≠ I355), G356 (= G356), I357 (= I357), I358 (≠ Q358)
- binding (6s)-5,6,7,8-tetrahydrofolate: I523 (≠ Y525), E536 (≠ D538), T538 (= T540), I550 (≠ V552), F612 (= F612), L613 (≠ G613), Y632 (= Y632), E639 (= E639), F680 (= F680), Y700 (≠ F700)
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
33% identity, 99% coverage: 6:816/816 of query aligns to 41:852/857 of Q63342
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
34% identity, 99% coverage: 6:816/816 of query aligns to 48:859/866 of Q9UI17
- CV 59:60 (≠ VI 17:18) binding
- EK 80:81 (≠ ER 38:39) binding
- 87:95 (vs. 45:53, 89% identical) binding
- H91 (= H49) modified: Tele-8alpha-FAD histidine
- H109 (≠ A67) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V177) binding
- S279 (≠ T243) to P: in dbSNP:rs532964
- FG-YGII 397:402 (≠ FNSIGIQ 352:358) binding
- A530 (≠ G487) to G: in dbSNP:rs1805073
- S646 (≠ P602) to P: in dbSNP:rs1805074
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
33% identity, 99% coverage: 9:815/816 of query aligns to 3:826/827 of 1pj7A
- active site: H222 (= H234), Y256 (= Y259), D549 (= D538)
- binding flavin-adenine dinucleotide: G8 (= G14), G10 (= G16), I11 (≠ V17), V12 (≠ I18), D32 (≠ E38), Q33 (≠ R39), G41 (= G45), S42 (≠ T46), T43 (= T47), H45 (= H49), P47 (≠ A51), L49 (= L53), T170 (≠ K176), V171 (= V177), A200 (= A212), G201 (= G213), W203 (= W215), H222 (= H234), Y256 (= Y259), I331 (≠ P326), V357 (≠ I355), W358 (≠ G356), V359 (≠ I357), T360 (≠ Q358)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: L505 (≠ F494), Y536 (= Y525), D549 (= D538), T551 (= T540), G563 (vs. gap), F629 (≠ G613), Y648 (= Y632), E655 (= E639), Y696 (≠ F680)
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
33% identity, 99% coverage: 9:815/816 of query aligns to 4:827/828 of 1pj6A
- active site: H223 (= H234), Y257 (= Y259), D550 (= D538)
- binding flavin-adenine dinucleotide: G9 (= G14), G11 (= G16), I12 (≠ V17), V13 (≠ I18), D33 (≠ E38), Q34 (≠ R39), G42 (= G45), S43 (≠ T46), T44 (= T47), H46 (= H49), P48 (≠ A51), L50 (= L53), V172 (= V177), A201 (= A212), G202 (= G213), W204 (= W215), H223 (= H234), Y257 (= Y259), G331 (= G325), I332 (≠ P326), V358 (≠ I355), W359 (≠ G356), V360 (≠ I357), T361 (≠ Q358)
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
32% identity, 100% coverage: 4:815/816 of query aligns to 1:829/830 of Q9AGP8
- IV 14:15 (≠ VI 17:18) binding
- DQ 35:36 (≠ ER 38:39) binding
- STSH 45:48 (≠ TTWH 46:49) binding
- L52 (= L53) binding
- V174 (= V177) binding
- H225 (= H234) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- Y259 (= Y259) Important for catalytic activity; binding ; mutation to F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- VWVT 360:363 (≠ IGIQ 355:358) binding
- Y539 (= Y525) binding
- D552 (= D538) Important for catalytic activity; mutation to A: No effect on the activity.; mutation to N: Reduces activity 3-fold.
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
33% identity, 99% coverage: 9:815/816 of query aligns to 3:826/827 of 3gsiA
- active site: H222 (= H234), Y256 (= Y259), A549 (≠ D538)
- binding flavin-adenine dinucleotide: G10 (= G16), I11 (≠ V17), V12 (≠ I18), D32 (≠ E38), Q33 (≠ R39), G41 (= G45), S42 (≠ T46), T43 (= T47), H45 (= H49), P47 (≠ A51), L49 (= L53), T170 (≠ K176), V171 (= V177), A200 (= A212), G201 (= G213), W203 (= W215), H222 (= H234), Y256 (= Y259), G330 (= G325), I331 (≠ P326), F332 (≠ E327), V357 (≠ I355), W358 (≠ G356), V359 (≠ I357), T360 (≠ Q358)
- binding magnesium ion: D254 (≠ C257), V409 (≠ G407)
- binding (6s)-5,6,7,8-tetrahydrofolate: L505 (≠ F494), Y536 (= Y525), T551 (= T540), G563 (vs. gap), F629 (≠ G613), Y648 (= Y632), E655 (= E639), Y696 (≠ F680)
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
28% identity, 47% coverage: 425:807/816 of query aligns to 1:356/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
28% identity, 47% coverage: 425:807/816 of query aligns to 1:356/362 of 1wopA
- active site: D96 (= D538)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: M51 (≠ F494), L55 (≠ R498), Y83 (= Y525), D96 (= D538), V98 (≠ T540), E106 (≠ A548), L108 (= L550), V110 (= V552), N112 (≠ P554), I137 (≠ V579), E160 (≠ P602), Y168 (≠ P611), Y169 (≠ F612), K173 (≠ Q616), S174 (≠ E617), I175 (= I618), E180 (≠ G623), T181 (≠ A625), Y188 (= Y632), E195 (= E639), M197 (≠ Y641), R227 (≠ M671), Y236 (≠ F680)
Sites not aligning to the query:
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
28% identity, 47% coverage: 425:807/816 of query aligns to 1:356/362 of 1wooA
- active site: D96 (= D538)
- binding (6s)-5,6,7,8-tetrahydrofolate: M51 (≠ F494), Y83 (= Y525), D96 (= D538), V98 (≠ T540), V110 (= V552), N112 (≠ P554), Y168 (≠ P611), Y169 (≠ F612), Y188 (= Y632), E195 (= E639), Y236 (≠ F680)
Sites not aligning to the query:
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
27% identity, 48% coverage: 426:813/816 of query aligns to 577:964/967 of Q46337
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 139 G→A: Does not affect activity and binding of NAD(+).
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
31% identity, 35% coverage: 426:712/816 of query aligns to 575:856/965 of Q50LF0
Sites not aligning to the query:
- 139 binding
- 158 binding
- 159 binding
- 160 binding
- 166 binding
- 205 binding
- 418 binding
- 423 binding
- 425 binding
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
31% identity, 35% coverage: 426:712/816 of query aligns to 574:855/963 of 3ad7A
Sites not aligning to the query:
- active site: 349, 374
- binding flavin mononucleotide: 509, 510, 516, 520, 548, 550
- binding nicotinamide-adenine-dinucleotide: 134, 136, 137, 138, 157, 158, 159, 165, 204, 248, 249, 294, 380, 416, 422, 423, 424
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
31% identity, 35% coverage: 426:712/816 of query aligns to 574:855/963 of 1vrqA
- active site: D676 (= D538)
- binding N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid: L631 (≠ F494), Y663 (= Y525), G677 (≠ V539), H690 (vs. gap), I774 (≠ V630), F776 (≠ Y632), E783 (= E639), K822 (= K678), F824 (= F680)
Sites not aligning to the query:
- active site: 349, 374
- binding flavin mononucleotide: 509, 510, 516, 520, 548, 550
- binding nicotinamide-adenine-dinucleotide: 134, 136, 137, 138, 157, 158, 159, 165, 204, 248, 249, 294, 380, 416, 422, 423, 424
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
28% identity, 47% coverage: 4:389/816 of query aligns to 1:369/374 of 1y56B
- active site: F44 (≠ W48), G47 (vs. gap), T48 (≠ A51), H224 (= H234), P239 (= P249), G305 (= G318), M338 (≠ Q358)
- binding flavin-adenine dinucleotide: G11 (= G14), G13 (= G16), I14 (≠ V17), V15 (≠ I18), I33 (≠ L37), E34 (= E38), K35 (≠ R39), S42 (≠ T46), T43 (= T47), R45 (≠ H49), C46 (≠ A50), G47 (vs. gap), G49 (= G52), E170 (≠ K176), V171 (= V177), T200 (≠ A212), N201 (≠ G213), W203 (= W215), G305 (= G318), Y306 (≠ I319), Y307 (≠ H320), G334 (≠ S354), H335 (≠ I355), G336 (= G356), F337 (≠ I357), M338 (≠ Q358)
- binding flavin mononucleotide: F44 (≠ W48), R45 (≠ H49), I260 (≠ L269), R301 (≠ L314), W303 (≠ E316)
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
28% identity, 48% coverage: 426:813/816 of query aligns to 575:962/965 of 2gagA
Sites not aligning to the query:
- active site: 350, 375
- binding flavin mononucleotide: 510, 511, 517, 521, 549, 551
- binding nicotinamide-adenine-dinucleotide: 134, 135, 137, 138, 139, 158, 159, 160, 165, 166, 204, 205, 249, 250, 295, 381, 417, 418, 423, 424, 425, 554
3a8iA Crystal structure of et-ehred-5-ch3-thf complex (see paper)
28% identity, 38% coverage: 464:774/816 of query aligns to 21:330/363 of 3a8iA
- active site: D97 (= D538)
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: M51 (≠ F494), Y84 (= Y525), D97 (= D538), I99 (≠ T540), V111 (= V552), N113 (≠ P554), F173 (= F612), Y188 (= Y632), E195 (= E639), R223 (≠ M671), M232 (≠ F680), W252 (≠ F700)
P48728 Aminomethyltransferase, mitochondrial; Glycine cleavage system T protein; GCVT; EC 2.1.2.10 from Homo sapiens (Human) (see 4 papers)
27% identity, 43% coverage: 425:776/816 of query aligns to 33:368/403 of P48728
- D129 (= D538) mutation D->A,N: Loss of aminomethyltransferase activity.
- N145 (≠ P554) to I: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs386833682
- E232 (= E639) binding
- R261 (≠ M671) binding
- G269 (= G679) to D: in GCE2; decreased aminomethyltransferase activity; dbSNP:rs121964981
- R320 (≠ L728) to H: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs121964985
Sites not aligning to the query:
1wsvA Crystal structure of human t-protein of glycine cleavage system (see paper)
27% identity, 43% coverage: 425:776/816 of query aligns to 2:337/371 of 1wsvA
- active site: D98 (= D538)
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: M53 (≠ F494), L85 (≠ Y525), D98 (= D538), L99 (≠ V539), I100 (≠ T540), V112 (= V552), N114 (≠ P554), F173 (= F612), G193 (≠ T631), Y194 (= Y632), E201 (= E639), R230 (≠ M671), L239 (≠ F680)
Sites not aligning to the query:
Query Sequence
>GFF3260 FitnessBrowser__Phaeo:GFF3260
MSDLPNKARVVIIGGGVIGCSVAYHLTKLGWKDVVLLERKQLTSGTTWHAAGLIAQLRAT
ANMTKLAKYSQELYGALEEETGVATGFKRCGSITVALTEERKEEIFRQAAMARAFGVEVE
EISPEEVKTRYEHLNVGDVTAGVWLPKDGQGDPANIALALAKGARQRGALVKERIKVTGI
SKEGRRATGVDWASDDSQSQGHIEADMVVNCAGMWGHEVGRMAGVNVPLHACEHFYIVTE
GITGLTQMPVLRVPDECAYYKEDAGKILLGAFEPNAKPWAMNGIPDTFEFDQLPEDFDHF
EPILEAACNRMPMLAEAGIHTFFNGPESFTPDDAYHLGLAPEMDNVWVAAGFNSIGIQSA
GGAGMALAQWMEDGQKPFDIGDVDISRMQPFQGNKNYLFERSKETLGLLYADHFPYRQKA
TARGVRRTPFHHHLLEQGAVMGEIGGWERANWFANEGQEREYQYSWKRQNWFENSAAEHR
AVRENIGMYDMSSFGKIRVEGPDAEIFLNYICGANLSVPAGKIVYTQFLNARGGIEADVT
VTRLSETAYLVVTPAVTRLTDQTWMMRHVGDHRVVITDVTAGEGVLAVMGPNARKLLQKV
SPNDFSNAVNPFGTAQEIELGMGLARVHRVTYVGELGWEIYVSADMAGHAFETLHEAGQD
MGLKLCGMHMMDSCRIEKGFRHFGHDITCEDNVIDAGLGFAVKTDKADFIGKSAVLARKE
TGPMNRMLQFKLTESEPLLFHNEPIIRDGKYVGYLSSGNYGHTLAAAIGMGYVPCEGESA
ADVLGSSYEIDVCGVKVKAEVSLKPMYDPKSERVKQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory