Comparing GFF3277 FitnessBrowser__Phaeo:GFF3277 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3jtxB Crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution
40% identity, 94% coverage: 7:375/392 of query aligns to 5:376/393 of 3jtxB
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
26% identity, 93% coverage: 28:391/392 of query aligns to 16:375/380 of 2x5dD
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
26% identity, 95% coverage: 18:391/392 of query aligns to 14:382/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
26% identity, 95% coverage: 18:391/392 of query aligns to 14:382/388 of 1gd9A
6l1nA Substrate bound bacf structure from bacillus subtillis (see paper)
24% identity, 95% coverage: 8:378/392 of query aligns to 10:374/393 of 6l1nA
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
24% identity, 90% coverage: 28:378/392 of query aligns to 31:375/392 of 6l1oB
Sites not aligning to the query:
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
24% identity, 90% coverage: 28:378/392 of query aligns to 31:375/393 of 6l1lB
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
24% identity, 93% coverage: 28:391/392 of query aligns to 36:382/384 of 1o4sB
2o1bA Structure of aminotransferase from staphylococcus aureus
25% identity, 92% coverage: 31:392/392 of query aligns to 21:373/376 of 2o1bA
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
24% identity, 99% coverage: 5:391/392 of query aligns to 4:368/370 of Q58097
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
24% identity, 100% coverage: 1:391/392 of query aligns to 1:396/402 of 5wmiA
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
24% identity, 93% coverage: 28:391/392 of query aligns to 28:396/399 of 5wmhA
5wmlA Arabidopsis thaliana prephenate aminotransferase mutant- k306a (see paper)
24% identity, 93% coverage: 28:391/392 of query aligns to 29:397/404 of 5wmlA
Sites not aligning to the query:
1v2fA Crystal structure of t.Th hb8 glutamine aminotransferase complex with 3-phenylpropionate (see paper)
25% identity, 95% coverage: 15:387/392 of query aligns to 15:364/368 of 1v2fA
1v2eA Crystal structure of t.Th hb8 glutamine aminotransferase complex with a-keto-g-methylthiobutyrate (see paper)
25% identity, 95% coverage: 15:387/392 of query aligns to 15:364/368 of 1v2eA
4cvqA Crystal structure of an aminotransferase from escherichia coli at 2. 11 angstroem resolution (see paper)
25% identity, 73% coverage: 28:313/392 of query aligns to 32:319/404 of 4cvqA
P0A959 Glutamate-pyruvate aminotransferase AlaA; EC 2.6.1.2 from Escherichia coli (strain K12) (see paper)
25% identity, 73% coverage: 28:313/392 of query aligns to 32:319/405 of P0A959
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
23% identity, 94% coverage: 22:391/392 of query aligns to 24:382/385 of Q56232
Sites not aligning to the query:
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
23% identity, 94% coverage: 22:391/392 of query aligns to 24:382/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
23% identity, 94% coverage: 22:391/392 of query aligns to 24:382/382 of 1bjwA
>GFF3277 FitnessBrowser__Phaeo:GFF3277
MNFPERFSNLPPYAFPRLRALLDHHTPGGDVVHMTIGEPKHDFPAWVTDVIVDNAAGFQS
YPPNEGSAELRGAISDWIKRRYDVSVDPMTQVMALNGTREGLYNAAMALCPEQKNGAKPV
VLIPNPFYQVYMVASISVAAEPVFVPATADTDHLPDYVGLPPEVLNRTAVAYICSPANPQ
GAVASRAYWTQLIQLAEQYDFRIFADECYSEIYRASAPVGALSVAQELGADPERVVLFNS
LSKRSNLAGLRSGLIAGGPDTMKRVHQLRAYSGAPLPAPLQAAAARVWADEAHVTENRAL
YQEKYRIADQVFDGLDGYMAPEAGFFLWLPVEDGEAAALKLWQDTGVRVLPGAYLAQGDG
TANPGKGYIRVALVAPAEQTEVALRTLRSCLY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory