SitesBLAST
Comparing GFF3281 FitnessBrowser__WCS417:GFF3281 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 98% coverage: 2:253/257 of query aligns to 1:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 98% coverage: 2:253/257 of query aligns to 1:253/254 of 1g6hA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 97% coverage: 4:253/257 of query aligns to 1:235/240 of 6mjpA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 98% coverage: 5:256/257 of query aligns to 17:252/378 of P69874
- C26 (≠ S14) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F15) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ I33) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ A42) mutation to T: Loss of ATPase activity and transport.
- L60 (= L48) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ F64) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (≠ L141) mutation to M: Loss of ATPase activity and transport.
- D172 (= D178) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 95% coverage: 4:246/257 of query aligns to 1:228/241 of 4u00A
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
29% identity, 97% coverage: 4:253/257 of query aligns to 1:234/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
29% identity, 97% coverage: 4:253/257 of query aligns to 1:234/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F15), S37 (≠ N40), G38 (= G41), C39 (≠ A42), G40 (= G43), K41 (= K44), S42 (= S45), T43 (≠ S46), Q81 (= Q87), R128 (≠ V149), A132 (≠ N153), S134 (= S155), G136 (= G157), Q137 (≠ L158), E158 (= E179), H191 (= H212)
- binding magnesium ion: S42 (= S45), Q81 (= Q87)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
29% identity, 97% coverage: 4:253/257 of query aligns to 1:234/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F15), G38 (= G41), C39 (≠ A42), G40 (= G43), K41 (= K44), S42 (= S45), T43 (≠ S46), R128 (≠ V149), S134 (= S155), Q137 (≠ L158)
- binding beryllium trifluoride ion: S37 (≠ N40), G38 (= G41), K41 (= K44), Q81 (= Q87), S134 (= S155), G136 (= G157), H191 (= H212)
- binding magnesium ion: S42 (= S45), Q81 (= Q87)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
29% identity, 97% coverage: 4:253/257 of query aligns to 1:234/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F15), V17 (≠ A20), G38 (= G41), C39 (≠ A42), G40 (= G43), K41 (= K44), S42 (= S45), T43 (≠ S46), R128 (≠ V149), A132 (≠ N153), S134 (= S155), Q137 (≠ L158)
- binding tetrafluoroaluminate ion: S37 (≠ N40), G38 (= G41), K41 (= K44), Q81 (= Q87), S134 (= S155), G135 (≠ Y156), G136 (= G157), E158 (= E179), H191 (= H212)
- binding magnesium ion: S42 (= S45), Q81 (= Q87)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
29% identity, 97% coverage: 4:253/257 of query aligns to 1:234/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F15), V17 (≠ A20), G38 (= G41), C39 (≠ A42), G40 (= G43), K41 (= K44), S42 (= S45), T43 (≠ S46), R128 (≠ V149), A132 (≠ N153), S134 (= S155), Q137 (≠ L158)
- binding magnesium ion: S42 (= S45), Q81 (= Q87)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
29% identity, 97% coverage: 4:253/257 of query aligns to 2:235/371 of P68187
- A85 (= A90) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ E126) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A134) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ I137) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E139) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ Q144) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G157) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D178) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (≠ E246) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
30% identity, 97% coverage: 4:253/257 of query aligns to 1:235/235 of 6mhzA
- binding adp orthovanadate: Y12 (≠ F15), N37 (= N40), G38 (= G41), G40 (= G43), K41 (= K44), T42 (≠ S45), T43 (≠ S46), Q84 (= Q87), S136 (≠ N153), S138 (= S155), G139 (≠ Y156), G140 (= G157), E162 (= E179), G166 (= G183), H194 (= H212)
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
28% identity, 96% coverage: 6:253/257 of query aligns to 1:232/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F15), S35 (≠ N40), G36 (= G41), C37 (≠ A42), G38 (= G43), K39 (= K44), S40 (= S45), T41 (≠ S46), R126 (≠ V149), A130 (≠ N153), S132 (= S155), G134 (= G157), Q135 (≠ L158)
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
30% identity, 97% coverage: 4:253/257 of query aligns to 1:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
30% identity, 97% coverage: 4:253/257 of query aligns to 1:235/238 of 6s8gA
- binding phosphoaminophosphonic acid-adenylate ester: Y12 (≠ F15), R15 (≠ I18), N37 (= N40), G40 (= G43), K41 (= K44), T42 (≠ S45), T43 (≠ S46), Q84 (= Q87), S136 (≠ N153), S138 (= S155), E141 (≠ L158)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
29% identity, 97% coverage: 4:253/257 of query aligns to 2:235/369 of P19566
- L86 (= L91) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P180) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (≠ N185) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
30% identity, 94% coverage: 2:243/257 of query aligns to 1:230/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
30% identity, 94% coverage: 2:243/257 of query aligns to 1:230/263 of 7d08B
6mbnA Lptb e163q in complex with atp (see paper)
30% identity, 97% coverage: 4:253/257 of query aligns to 2:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
30% identity, 97% coverage: 4:252/257 of query aligns to 1:234/234 of 6b89A
- binding adenosine-5'-diphosphate: Y12 (≠ F15), R15 (≠ I18), V17 (≠ A20), N37 (= N40), G38 (= G41), G40 (= G43), K41 (= K44), T42 (≠ S45), T43 (≠ S46)
- binding magnesium ion: T42 (≠ S45), Q84 (= Q87)
- binding novobiocin: L71 (≠ P74), H72 (≠ L75), P83 (≠ F86), A86 (≠ N89), S87 (≠ A90), F89 (= F92), R90 (≠ K93), R91 (≠ K94), L92 (≠ M95), V101 (≠ G104), Q135 (≠ G152), R149 (= R166)
Query Sequence
>GFF3281 FitnessBrowser__WCS417:GFF3281
MSQAILQVRDISLSFKGIKAINALSFEVARGEICALIGPNGAGKSSLLNVLNGVYRFDAG
EIVFEDQHFHRIDPLGAARRGIGRTFQNNALFKKMSVLDNILTGLSRHMRSSVIEQALGL
PRARREAEAFRLRAQGILEFLELQAHRDVLVGNLSYGLQKRVELGRALIAGPSLLLLDEP
MAGMNAEEKQEMARFVADVNRDLGTTVVLIEHDMGVVMGLSDHVVVLDYGRKVGDGTPAD
VQANPEVIAAYLGVVNA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory