Comparing GFF3290 FitnessBrowser__psRCH2:GFF3290 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2jgvB Structure of staphylococcus aureus d-tagatose-6-phosphate kinase in complex with adp (see paper)
33% identity, 84% coverage: 4:265/312 of query aligns to 6:269/314 of 2jgvB
Sites not aligning to the query:
2jg1A Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
32% identity, 84% coverage: 4:265/312 of query aligns to 10:273/318 of 2jg1A
Sites not aligning to the query:
2jg1C Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
32% identity, 84% coverage: 4:265/312 of query aligns to 7:270/315 of 2jg1C
Sites not aligning to the query:
2f02A Crystal structure of lacc from enterococcus faecalis in complex with atp
33% identity, 87% coverage: 4:274/312 of query aligns to 3:276/319 of 2f02A
Sites not aligning to the query:
3ie7A The crystal structure of phosphofructokinase (lin2199) from listeria innocua in complex with atp at 1.6a
29% identity, 98% coverage: 4:308/312 of query aligns to 3:300/309 of 3ie7A
3julA Crystal structure of listeria innocua d-tagatose-6-phosphate kinase bound with substrate
29% identity, 91% coverage: 4:287/312 of query aligns to 3:278/298 of 3julA
3cqdA Structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli (see paper)
30% identity, 91% coverage: 1:284/312 of query aligns to 1:286/304 of 3cqdA
Sites not aligning to the query:
3uqdB Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
30% identity, 91% coverage: 1:284/312 of query aligns to 1:286/309 of 3uqdB
3uqdA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
30% identity, 91% coverage: 1:284/312 of query aligns to 1:286/309 of 3uqdA
Sites not aligning to the query:
3n1cA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate (see paper)
30% identity, 91% coverage: 1:284/312 of query aligns to 1:286/309 of 3n1cA
P06999 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; 6-phosphofructokinase isozyme II; Phosphohexokinase 2; EC 2.7.1.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 91% coverage: 1:284/312 of query aligns to 1:286/309 of P06999
Sites not aligning to the query:
3uqeA Crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli
30% identity, 91% coverage: 1:284/312 of query aligns to 1:286/307 of 3uqeA
Sites not aligning to the query:
2ajrA Crystal structure of possible 1-phosphofructokinase (ec 2.7.1.56) (tm0828) from thermotoga maritima at 2.46 a resolution
29% identity, 84% coverage: 4:266/312 of query aligns to 3:274/320 of 2ajrA
Sites not aligning to the query:
P9WID3 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; Phosphofructokinase B; Phosphohexokinase 2; Tagatose-6-phosphate kinase; EC 2.7.1.11; EC 2.7.1.144 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 85% coverage: 3:268/312 of query aligns to 13:279/339 of P9WID3
Sites not aligning to the query:
7w93A Crystal structure of e.Coli pseudouridine kinase psuk complexed with n1-methyl-pseudouridine (see paper)
27% identity, 83% coverage: 27:285/312 of query aligns to 24:286/307 of 7w93A
Sites not aligning to the query:
7vteA Uridine bound structure of pseudouridine kinase (puki) from escherichia coli strain b (see paper)
27% identity, 83% coverage: 26:285/312 of query aligns to 19:280/302 of 7vteA
Sites not aligning to the query:
7vtfA Cytidine bound structure of pseudouridine kinase (puki) from escherichia coli strain b (see paper)
27% identity, 83% coverage: 26:285/312 of query aligns to 19:280/301 of 7vtfA
Sites not aligning to the query:
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
26% identity, 91% coverage: 1:285/312 of query aligns to 1:290/313 of 6ilsB
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 47% coverage: 140:285/312 of query aligns to 207:356/379 of A1A6H3
Sites not aligning to the query:
4e84B Crystal structure of burkholderia cenocepacia hlda (see paper)
26% identity, 83% coverage: 39:298/312 of query aligns to 52:308/310 of 4e84B
Sites not aligning to the query:
>GFF3290 FitnessBrowser__psRCH2:GFF3290
MARVLTVTLNPALDLTVQLPALRLGEVNRSDSLQVHAAGKGLNVAQVLADLGHQLTVTGF
LGEGNPQAFEQLFSARGFTDEFVRVAGETRSNLKLAEADGRVTDINGPGLAVSEAQRAEL
LARLKRLVPAHELVVVAGSLPRGIDSQWFVQLLNSLKALGVRVALDTSGAALRDGLATRP
WLIKPNEEELAEARGIELSGSSALAAEAQRLQEEGIEHVVVSQGADGVSWFSPGAALHAS
PPKVRVVSTVGAGDSLLAGMLHGLLEGWPAERTLTHATAIAAQAVGQVGFGITDTAQLAE
LQAAVRLQPLSQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory