Comparing GFF3323 FitnessBrowser__Phaeo:GFF3323 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
50% identity, 86% coverage: 7:309/351 of query aligns to 3:299/382 of 7ahhC
7aheC Opua inhibited inward facing (see paper)
50% identity, 86% coverage: 7:309/351 of query aligns to 3:299/382 of 7aheC
7ahdC Opua (e190q) occluded (see paper)
54% identity, 74% coverage: 7:264/351 of query aligns to 3:259/260 of 7ahdC
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
40% identity, 66% coverage: 37:269/351 of query aligns to 12:244/375 of 2d62A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 77% coverage: 6:276/351 of query aligns to 1:249/343 of P30750
Sites not aligning to the query:
1g291 Malk (see paper)
40% identity, 68% coverage: 31:269/351 of query aligns to 3:241/372 of 1g291
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 77% coverage: 6:276/351 of query aligns to 2:250/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 77% coverage: 6:276/351 of query aligns to 2:250/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 77% coverage: 6:276/351 of query aligns to 2:250/344 of 3tuiC
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 64% coverage: 47:272/351 of query aligns to 33:252/378 of P69874
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
37% identity, 67% coverage: 36:271/351 of query aligns to 6:239/240 of 4ymuJ
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
40% identity, 65% coverage: 41:269/351 of query aligns to 16:230/353 of 1vciA
8hplC Lpqy-sugabc in state 1 (see paper)
38% identity, 64% coverage: 47:269/351 of query aligns to 17:233/384 of 8hplC
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
38% identity, 64% coverage: 47:269/351 of query aligns to 19:235/362 of 8hprD
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
38% identity, 64% coverage: 47:269/351 of query aligns to 19:235/363 of 8hprC
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 63% coverage: 47:268/351 of query aligns to 20:235/393 of P9WQI3
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
43% identity, 56% coverage: 47:244/351 of query aligns to 23:218/226 of 5xu1B
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
37% identity, 66% coverage: 37:269/351 of query aligns to 8:234/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
37% identity, 66% coverage: 37:269/351 of query aligns to 8:234/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
37% identity, 66% coverage: 37:269/351 of query aligns to 8:234/371 of 3puxA
>GFF3323 FitnessBrowser__Phaeo:GFF3323
MSTETVVEISNVWKIFGHNPQAALQAIRDRGLSKAEVLSEMGAVVGVADISLSVNRGEIF
CIMGLSGSGKSTLVRHFNRLLEPTAGKIEIEGTDVMALGAKNLQQFRNNKIGMVFQNFAL
MPHRSVLDNVAMPLEIRQVAKNERMRQAAAILDVVELGAWSSKFAHELSGGMQQRVGLAR
ALAANPDVLLMDEPFSALDPLIRRQLQDEFIRLSKILKKTTIFITHDLDEAVRIGDRIAI
MRDGKMVQMGTAEDIVMHPADDYVADFVAGISRLKVVHAHAVMQPLEAYVAAQGPIAADA
PRVEENETLSNLINIAIDDEKPIVVQADRKELGVITRTDLLRTVIEGTEVS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory