Comparing GFF3329 FitnessBrowser__Marino:GFF3329 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
32% identity, 83% coverage: 18:376/431 of query aligns to 10:372/399 of 6f77A
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
32% identity, 83% coverage: 18:376/431 of query aligns to 11:373/400 of Q02635
1j32A Aspartate aminotransferase from phormidium lapideum
33% identity, 83% coverage: 15:372/431 of query aligns to 7:357/388 of 1j32A
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
30% identity, 87% coverage: 12:384/431 of query aligns to 8:377/402 of P14909
Sites not aligning to the query:
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
30% identity, 84% coverage: 11:372/431 of query aligns to 4:355/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
30% identity, 84% coverage: 11:372/431 of query aligns to 4:355/382 of 1bjwA
Sites not aligning to the query:
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
30% identity, 84% coverage: 11:372/431 of query aligns to 4:355/385 of Q56232
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
29% identity, 84% coverage: 11:372/431 of query aligns to 4:355/382 of 1b5oA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
29% identity, 84% coverage: 11:372/431 of query aligns to 4:355/382 of 1gc4A
Sites not aligning to the query:
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
29% identity, 84% coverage: 11:372/431 of query aligns to 4:355/382 of 1gc3A
Sites not aligning to the query:
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
31% identity, 85% coverage: 11:375/431 of query aligns to 3:382/410 of P58350
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
31% identity, 83% coverage: 15:372/431 of query aligns to 6:369/399 of 5wmhA
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
30% identity, 84% coverage: 15:375/431 of query aligns to 8:372/400 of 6f35A
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
29% identity, 97% coverage: 11:430/431 of query aligns to 10:384/384 of 1o4sB
5wmlA Arabidopsis thaliana prephenate aminotransferase mutant- k306a (see paper)
31% identity, 83% coverage: 15:372/431 of query aligns to 7:370/404 of 5wmlA
Sites not aligning to the query:
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
31% identity, 83% coverage: 15:372/431 of query aligns to 7:369/402 of 5wmiA
Sites not aligning to the query:
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
32% identity, 78% coverage: 38:372/431 of query aligns to 25:353/388 of 1gdeA
Sites not aligning to the query:
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
32% identity, 78% coverage: 38:372/431 of query aligns to 25:353/388 of 1gd9A
8wkjA The crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila (see paper)
29% identity, 82% coverage: 21:372/431 of query aligns to 14:363/391 of 8wkjA
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
30% identity, 80% coverage: 30:372/431 of query aligns to 20:361/393 of 1xi9C
>GFF3329 FitnessBrowser__Marino:GFF3329
MDIQNDHRYAINLNVRGIQPSATLRINELSNHLKSEGKDIIKLGLGQSPFPVPDRVVEAL
KEHAHEKDYLPVKGLKGLREAIAGYIRRSERMHCTWEDVLIGPGSKELLFMLQLAYYGDL
LIPRPSWVSYAPQARIIGRSVHWLPTHAENNWQLTAEELDIICRDDPSRPRILILNYPSN
PTGCTYTDDQLLAIANVARKYRLILLSDEIYGEVHFEGRHKSIARYYPEGTIISTGLSKW
AGAGGWRLGTFIFPRELRPLQDAMAIIASETYTATSAPIQHAAIAAFNGGDDIDEYLKQS
RRVLKVVGEYMHRRLSDMGAVVQKPEGAFYLFPDFSGFREQLASKDIKTSQAFCQALLEN
TGVAILPASDFGFVPDHLAARLAFVDFDGAESLELAGGDYAEQELGDDFVKQACPRLVTA
MDKMEQWLNSL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory