Comparing GFF3330 FitnessBrowser__Marino:GFF3330 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
37% identity, 85% coverage: 4:237/274 of query aligns to 2:235/270 of 6ib8B
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
38% identity, 83% coverage: 10:237/274 of query aligns to 4:231/267 of P0ADG4
Sites not aligning to the query:
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
38% identity, 83% coverage: 10:237/274 of query aligns to 4:231/262 of 2qflA
6tqoT Rrn anti-termination complex (see paper)
37% identity, 83% coverage: 10:237/274 of query aligns to 4:223/255 of 6tqoT
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 98% coverage: 1:268/274 of query aligns to 1:267/271 of Q9M8S8
Q19420 Inositol monophosphatase ttx-7; IMP; IMPase; Abnormal thermotaxis protein 7; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase; EC 3.1.3.25; EC 3.1.3.94 from Caenorhabditis elegans (see paper)
32% identity, 91% coverage: 11:258/274 of query aligns to 14:266/285 of Q19420
2p3nA Thermotoga maritima impase tm1415 (see paper)
35% identity, 89% coverage: 12:255/274 of query aligns to 5:234/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
35% identity, 89% coverage: 12:255/274 of query aligns to 5:234/256 of O33832
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
32% identity, 89% coverage: 9:253/274 of query aligns to 3:247/266 of 1imdA
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
32% identity, 89% coverage: 9:253/274 of query aligns to 3:247/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
32% identity, 89% coverage: 9:253/274 of query aligns to 3:247/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
32% identity, 89% coverage: 9:253/274 of query aligns to 3:247/272 of 1awbA
6zk0AAA human impase with ebselen (see paper)
32% identity, 89% coverage: 9:253/274 of query aligns to 4:248/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
32% identity, 89% coverage: 9:253/274 of query aligns to 5:249/274 of 4as4A
P29218 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Homo sapiens (Human) (see 5 papers)
32% identity, 89% coverage: 9:253/274 of query aligns to 7:251/277 of P29218
6giuA Human impase with l-690330 (see paper)
32% identity, 89% coverage: 9:253/274 of query aligns to 5:249/275 of 6giuA
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
32% identity, 91% coverage: 9:256/274 of query aligns to 7:254/277 of P20456
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
32% identity, 91% coverage: 9:256/274 of query aligns to 5:252/274 of 2bjiA
O14732 Inositol monophosphatase 2; IMP 2; IMPase 2; Inositol-1(or 4)-monophosphatase 2; Myo-inositol monophosphatase A2; EC 3.1.3.25 from Homo sapiens (Human) (see 2 papers)
33% identity, 81% coverage: 9:230/274 of query aligns to 18:243/288 of O14732
2cziA Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions (see paper)
34% identity, 87% coverage: 9:247/274 of query aligns to 4:233/259 of 2cziA
>GFF3330 FitnessBrowser__Marino:GFF3330
MSDSVSLLEITDFAENLAREAGELIRRERDSNALRTDYKHQTELVTHADVMADEFITGAI
RKRFPGHRILSEETMPDLSQAEELDTPLWIVDPIDGTVNYAYGHPQVAVSIAYAEKGRVQ
AGVVHAPFPGETFRATRSEGATLNNHPIRHSGATVPRDALFATGFPYTKDALEPLVKRLD
AMIHQCRDLRRIGSAALDICWVACGRLDIYYENVSPWDFAAARLIALEAGATAGHFSEVP
DGYPADLWGRDILISAPALWEPVRSILRSASGYD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory