SitesBLAST – Find functional sites

 

SitesBLAST

Comparing GFF3340 FitnessBrowser__Phaeo:GFF3340 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 17 hits to proteins with known functional sites (download)

6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
46% identity, 94% coverage: 13:228/229 of query aligns to 11:232/233 of 6j5yA

query
sites
6j5yA
A
 
S
I
 
L
P
 
T
V
 
I
E
 
H
G
 
G
R
 
S
D
 
D
E
 
Q
S
 
T
W
 
F
P
 
P
I
 
V
G
 
R
R
 
R
I
 
V
F
 
Y
C
 
C
V
|
V
G
|
G
R
|
R
N
 
N
Y
 
Y
A
 
A
A
 
A
H
|
H
A
 
A
A
 
R
E
 
E
M
 
M
G
 
G
V
 
F
E
 
D
V
 
P
D
 
E
R
 
R
E
 
E
Q
 
P
P
 
P
F
 
F
Y
 
F
F
|
F
T
 
C
K
 
K
S
 
P
A
 
A
C
 
D
H
 
A
A
 
V
V
 
V
L
 
P
S
 
V
G
 
A
A
 
A
-
 
G
-
 
S
-
 
T
-
 
L
E
 
E
V
 
L
P
 
A
Y
 
Y
P
 
P
Q
 
S
G
 
Q
T
 
T
E
 
G
N
 
N
F
 
Y
H
 
H
H
 
Y
E
|
E
M
 
I
E
|
E
L
 
L
V
 
V
V
 
A
A
 
A
I
 
I
S
 
G
A
 
K
P
 
G
L
 
G
Q
 
C
D
 
D
A
 
I
T
 
P
V
 
L
A
 
E
Q
 
Q
A
 
A
R
 
E
A
 
E
A
 
H
I
 
V
W
 
W
G
 
G
Y
 
Y
G
 
A
C
 
V
A
 
G
L
 
L
D
|
D
M
 
M
T
 
T
R
 
R
R
 
R
D
 
D
L
 
L
Q
 
Q
L
 
M
R
 
R
E
 
M
R
 
R
Q
 
E
K
 
M
Q
 
G
R
 
R
P
 
P
W
 
W
S
 
E
L
 
I
G
 
G
K
|
K
D
 
A
L
 
F
E
 
D
N
 
R
G
 
S
S
 
A
V
 
P
F
 
I
A
 
G
P
 
P
L
 
L
R
 
Y
A
 
P
A
 
A
E
 
S
D
 
Q
W
 
V
G
 
G
A
 
H
P
 
P
G
 
R
D
 
H
Q
 
A
R
 
A
I
 
I
W
 
S
L
 
L
R
 
Q
V
 
V
N
 
D
D
 
G
E
 
E
I
 
D
R
 
R
Q
 
Q
D
 
R
A
 
S
S
 
D
L
 
I
A
 
D
E
 
Q
L
 
L
I
 
I
W
 
W
S
 
S
V
 
V
E
 
A
D
 
E
I
 
T
L
 
V
C
 
S
H
 
Y
L
 
L
S
 
S
L
 
R
Y
 
F
Y
 
F
H
 
E
L
 
L
R
 
R
P
 
P
G
 
G
D
 
D
L
 
L
V
 
V
M
 
F
T
 
T
G
|
G
T
|
T
P
 
P
A
 
E
G
 
G
V
 
V
G
 
G
P
 
A
V
 
V
V
 
E
A
 
R
G
 
G
D
 
E
D
 
R
I
 
M
E
 
L
G
 
G
G
 
A
I
 
I
D
 
D
G
 
G
L
 
L
-
 
G
-
 
E
M
 
L
P
 
S
V
 
V
R
 
R
L
 
V
A
 
V
L
 
L

6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
38% identity, 90% coverage: 23:229/229 of query aligns to 8:214/216 of 6sbiA

query
sites
6sbiA
W
 
W
P
 
E
I
 
W
G
 
G
R
 
K
-
 
N
I
 
I
F
 
V
C
 
C
V
|
V
G
|
G
R
|
R
N
 
N
Y
 
Y
A
 
A
A
 
D
H
|
H
A
 
V
A
 
K
E
 
E
M
 
M
G
 
R
V
 
S
E
 
T
V
 
V
D
 
L
R
 
S
E
 
E
Q
 
-
P
 
P
F
 
V
Y
 
L
F
|
F
T
 
L
K
 
K
S
 
P
A
x
S
C
 
T
H
 
A
A
 
Y
V
 
A
L
 
P
S
 
E
G
 
G
A
 
S
E
 
P
V
 
V
P
 
L
Y
 
M
P
 
P
Q
 
A
G
 
Y
T
 
C
E
 
R
N
 
N
F
 
L
H
 
H
H
 
H
E
|
E
M
 
V
E
|
E
L
 
L
V
 
G
V
 
V
A
 
L
I
 
L
S
 
G
A
 
K
P
 
R
L
 
G
Q
 
E
D
 
A
A
 
I
T
 
P
V
 
E
A
 
A
Q
 
A
A
 
A
R
 
M
A
 
D
A
 
Y
I
 
V
W
 
A
G
 
G
Y
 
Y
G
 
A
C
 
L
A
 
C
L
 
L
D
|
D
M
 
M
T
 
T
R
 
A
R
 
R
D
 
D
L
 
V
Q
 
Q
L
 
E
R
 
E
E
 
C
R
 
K
Q
 
K
K
 
K
Q
 
G
R
 
L
P
 
P
W
 
W
S
 
T
L
 
L
G
 
A
K
|
K
D
 
S
L
 
F
E
 
T
N
 
S
G
 
S
S
 
C
V
 
P
F
 
V
A
 
S
P
 
A
L
 
F
R
 
V
A
 
P
A
 
K
E
 
E
D
 
K
W
 
I
G
 
P
A
 
D
P
 
P
G
 
H
D
 
A
Q
 
L
R
 
R
I
 
L
W
 
W
L
 
L
R
 
K
V
 
V
N
 
N
D
 
G
E
 
E
I
 
L
R
 
R
Q
 
Q
D
 
E
A
 
G
S
 
K
L
 
T
A
 
S
E
 
S
L
 
M
I
 
I
W
 
F
S
 
S
V
 
I
E
 
P
D
 
Y
I
 
I
L
 
I
C
 
S
H
 
Y
L
 
V
S
 
S
L
 
K
Y
 
I
Y
 
I
H
x
T
L
 
L
R
 
E
P
 
E
G
 
G
D
 
D
L
 
L
V
 
I
M
 
L
T
 
T
G
|
G
T
|
T
P
 
P
A
 
K
G
 
G
V
|
V
G
 
G
P
 
P
V
 
I
V
 
K
A
 
E
G
 
N
D
 
D
D
 
E
I
 
I
E
 
E
G
 
A
G
 
G
I
 
I
D
 
D
G
 
G
L
 
V
M
 
V
P
 
S
V
 
M
R
 
R
L
 
F
A
 
K
L
 
V
R
 
K

Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
37% identity, 90% coverage: 23:228/229 of query aligns to 14:219/224 of Q6P587

query
sites
Q6P587
W
 
W
P
 
E
I
 
W
G
 
G
R
 
K
-
 
N
I
 
I
F
 
V
C
 
C
V
 
V
G
 
G
R
 
R
N
 
N
Y
 
Y
A
 
A
A
 
D
H
|
H
A
 
V
A
 
R
E
|
E
M
 
M
G
 
R
V
 
S
E
 
A
V
 
V
D
 
L
R
 
S
E
 
E
Q
 
-
P
 
P
F
 
V
Y
 
L
F
 
F
T
 
L
K
 
K
S
 
P
A
 
S
C
 
T
H
 
A
A
 
Y
V
 
A
L
 
P
S
 
E
G
 
G
A
 
S
E
 
P
V
 
I
P
 
L
Y
 
M
P
 
P
Q
 
A
G
 
Y
T
 
T
E
 
R
N
 
N
F
 
L
H
 
H
H
 
H
E
|
E
M
 
L
E
|
E
L
 
L
V
 
G
V
 
V
A
 
V
I
 
M
S
 
G
A
 
K
P
 
R
L
 
C
Q
 
R
D
 
A
A
 
V
T
 
P
V
 
E
A
 
A
Q
 
A
A
 
A
R
 
M
A
 
D
A
 
Y
I
 
V
W
 
G
G
 
G
Y
 
Y
G
 
A
C
 
L
A
 
C
L
 
L
D
|
D
M
 
M
T
 
T
R
 
A
R
|
R
D
 
D
L
 
V
Q
 
Q
L
 
D
R
 
E
E
 
C
R
 
K
Q
 
K
K
 
K
Q
 
G
R
 
L
P
 
P
W
 
W
S
 
T
L
 
L
G
 
A
K
 
K
D
 
S
L
 
F
E
 
T
N
 
A
G
 
S
S
 
C
V
 
P
F
 
V
A
 
S
P
 
A
L
 
F
R
 
V
A
 
P
A
 
K
E
 
E
D
 
K
W
 
I
G
 
P
A
 
D
P
 
P
G
 
H
D
 
K
Q
 
L
R
 
K
I
 
L
W
 
W
L
 
L
R
 
K
V
 
V
N
 
N
D
 
G
E
 
E
I
 
L
R
 
R
Q
 
Q
D
 
E
A
 
G
S
 
E
L
 
T
A
 
S
E
 
S
L
 
M
I
 
I
W
 
F
S
 
S
V
 
I
E
 
P
D
 
Y
I
 
I
L
 
I
C
 
S
H
 
Y
L
 
V
S
 
S
L
 
K
Y
 
I
Y
 
I
H
 
T
L
 
L
R
 
E
P
 
E
G
 
G
D
 
D
L
 
I
V
 
I
M
 
L
T
 
T
G
 
G
T
 
T
P
 
P
A
 
K
G
 
G
V
 
V
G
 
G
P
 
P
V
 
V
V
 
K
A
 
E
G
 
N
D
 
D
D
 
E
I
 
I
E
 
E
G
 
A
G
 
G
I
 
I
D
 
H
G
 
G
L
 
L
M
 
V
P
 
S
V
 
M
R
 
T
L
 
F
A
 
K
L
 
V

6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
37% identity, 90% coverage: 23:228/229 of query aligns to 9:214/218 of 6fogA

query
sites
6fogA
W
 
W
P
 
E
I
 
W
G
 
G
R
x
K
-
x
N
I
 
I
F
 
V
C
 
C
V
|
V
G
|
G
R
|
R
N
 
N
Y
 
Y
A
 
A
A
 
D
H
|
H
A
 
V
A
 
R
E
 
E
M
 
M
G
 
R
V
 
S
E
 
A
V
 
V
D
 
L
R
 
S
E
 
E
Q
 
-
P
 
P
F
 
V
Y
 
L
F
|
F
T
 
L
K
 
K
S
 
P
A
 
S
C
 
T
H
 
A
A
 
Y
V
 
A
L
 
P
S
 
E
G
 
G
A
 
S
E
 
P
V
 
I
P
 
L
Y
 
M
P
 
P
Q
 
A
G
 
Y
T
 
T
E
 
R
N
 
N
F
 
L
H
 
H
H
 
H
E
|
E
M
 
L
E
|
E
L
 
L
V
 
G
V
 
V
A
 
V
I
 
M
S
 
G
A
 
K
P
 
R
L
 
C
Q
 
R
D
 
A
A
 
V
T
 
P
V
 
E
A
 
A
Q
 
A
A
 
A
R
 
M
A
 
D
A
 
Y
I
 
V
W
 
G
G
 
G
Y
 
Y
G
 
A
C
 
L
A
 
C
L
 
L
D
|
D
M
 
M
T
 
T
R
 
A
R
 
R
D
 
D
L
 
V
Q
 
Q
L
 
D
R
 
E
E
 
C
R
 
K
Q
 
K
K
 
K
Q
 
G
R
 
L
P
 
P
W
 
W
S
 
T
L
 
L
G
 
A
K
|
K
D
 
S
L
 
F
E
 
T
N
 
A
G
 
S
S
 
C
V
 
P
F
 
V
A
 
S
P
 
A
L
 
F
R
 
V
A
 
P
A
 
K
E
 
E
D
 
K
W
 
I
G
 
P
A
 
D
P
 
P
G
 
H
D
 
K
Q
 
L
R
 
K
I
 
L
W
 
W
L
 
L
R
 
K
V
 
V
N
 
N
D
 
G
E
 
E
I
 
L
R
 
R
Q
 
Q
D
 
E
A
 
G
S
 
E
L
 
T
A
 
S
E
 
S
L
 
M
I
 
I
W
 
F
S
 
S
V
 
I
E
 
P
D
 
Y
I
 
I
L
 
I
C
 
S
H
 
Y
L
 
V
S
 
S
L
 
K
Y
 
I
Y
 
I
H
 
T
L
 
L
R
 
E
P
 
E
G
 
G
D
 
D
L
 
I
V
 
I
M
 
L
T
 
T
G
|
G
T
|
T
P
 
P
A
 
K
G
 
G
V
 
V
G
 
G
P
 
P
V
 
V
V
 
K
A
 
E
G
 
N
D
 
D
D
 
E
I
 
I
E
 
E
G
 
A
G
 
G
I
 
I
D
 
H
G
 
G
L
 
L
M
 
V
P
 
S
V
 
M
R
 
T
L
 
F
A
 
K
L
 
V

3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
35% identity, 85% coverage: 25:219/229 of query aligns to 15:210/224 of 3v77A

query
sites
3v77A
I
 
L
G
 
G
R
 
K
I
 
I
F
 
V
C
 
C
V
 
V
G
 
G
R
 
R
N
 
N
Y
 
Y
A
 
A
A
 
A
H
 
H
A
 
A
A
 
K
E
 
E
M
 
L
G
 
N
V
 
N
E
 
P
V
 
I
D
 
P
R
 
S
E
 
-
Q
 
S
P
 
P
F
 
I
Y
 
L
F
 
F
T
 
I
K
 
K
S
 
P
A
 
A
C
 
S
H
 
S
A
 
A
V
 
V
L
 
P
S
 
F
G
 
G
A
 
P
E
 
V
V
 
F
P
 
S
Y
 
I
P
 
P
Q
 
K
G
 
D
T
 
Q
E
 
G
N
 
S
F
 
V
H
 
H
H
 
H
E
 
E
M
 
L
E
|
E
L
 
I
V
 
A
V
 
I
A
 
L
I
 
I
S
 
G
A
 
K
P
 
A
L
 
L
Q
 
S
D
 
R
A
 
A
T
 
S
V
 
T
A
 
E
Q
 
Q
A
 
V
R
 
A
A
 
E
A
 
S
I
 
I
W
 
A
G
 
G
Y
 
I
G
 
G
C
 
L
A
 
G
L
 
L
D
|
D
M
 
L
T
 
T
R
 
L
R
 
R
D
 
D
L
 
V
Q
 
Q
L
 
D
R
 
Q
E
 
L
R
 
K
Q
 
E
K
 
K
Q
 
G
R
 
H
P
 
P
W
 
W
S
 
E
L
 
R
G
 
A
K
 
K
D
 
S
L
 
F
E
 
D
N
 
G
G
 
A
S
 
C
-
 
P
-
 
L
-
 
T
-
 
E
-
 
F
V
 
V
F
 
A
A
 
V
P
 
N
L
 
L
R
 
A
A
 
S
A
 
E
E
 
D
D
 
E
W
 
W
G
 
Q
A
 
A
P
 
I
G
 
G
D
 
-
Q
 
-
R
 
-
I
 
L
W
 
T
L
 
L
R
 
E
V
 
K
N
 
N
D
 
G
E
 
Q
I
 
F
R
 
Q
Q
 
Q
D
 
Q
A
 
G
S
 
S
L
 
S
A
 
A
E
 
E
L
 
M
I
 
L
W
 
F
S
 
P
V
 
I
E
 
L
D
 
P
I
 
L
L
 
I
C
 
A
H
|
H
L
 
M
S
 
S
L
 
E
Y
x
H
Y
 
F
H
 
S
L
 
L
R
 
Q
P
 
P
G
 
G
D
 
D
L
 
V
V
 
I
M
 
L
T
 
T
G
 
G
T
 
T
P
 
P
A
 
A
G
 
G
V
 
V
G
 
G
P
 
P
V
 
L
V
 
E
A
 
V
G
 
G
D
 
D
D
 
S
I
 
L
E
 
S
G
 
A
G
 
K
I
 
L
D
 
S

1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
30% identity, 82% coverage: 27:214/229 of query aligns to 10:218/247 of 1nkqA

query
sites
1nkqA
R
 
K
I
 
I
F
 
I
C
 
C
V
 
I
G
 
G
R
 
R
N
 
N
Y
 
Y
A
 
A
A
 
A
H
 
H
A
 
I
A
 
K
E
 
E
M
 
L
G
 
N
V
 
-
E
 
-
V
 
-
D
 
-
R
 
-
E
 
N
Q
 
Q
P
 
P
F
 
F
Y
 
F
F
 
F
T
 
L
K
 
K
S
 
P
A
 
T
C
 
S
H
 
S
A
 
I
V
 
V
L
 
T
S
 
P
G
 
L
A
 
S
E
 
S
V
 
S
P
 
P
-
 
A
-
 
N
-
 
S
-
 
T
-
 
F
-
 
N
-
 
G
-
 
L
-
 
N
-
 
E
-
 
D
-
 
G
-
 
T
-
 
N
-
 
P
-
 
G
-
 
P
-
 
I
-
 
F
Y
 
I
P
 
P
Q
 
R
G
 
G
T
 
V
E
 
K
N
 
-
F
 
V
H
 
H
H
 
H
E
|
E
M
 
I
E
|
E
L
 
L
V
 
A
V
 
L
A
 
I
I
 
V
S
 
S
A
 
K
P
 
H
L
 
L
Q
 
S
D
 
N
A
 
V
T
 
T
V
 
K
A
 
M
Q
 
K
A
 
P
R
 
E
A
 
E
-
 
V
-
 
Y
-
 
D
A
 
S
I
 
I
W
 
S
G
 
G
Y
 
V
G
 
A
C
 
L
A
 
A
L
 
L
D
|
D
M
 
L
T
 
T
R
 
A
R
 
R
D
 
N
L
 
V
Q
 
Q
L
 
D
R
 
E
E
 
A
R
 
K
Q
 
K
K
 
K
Q
 
G
R
 
L
P
 
P
W
 
W
S
 
T
L
 
I
G
 
S
K
 
K
D
 
G
L
 
F
E
 
D
N
 
T
G
 
F
S
 
M
V
 
P
F
 
I
A
 
S
P
 
A
L
 
I
R
 
V
A
 
S
A
 
R
E
 
E
D
 
K
W
 
F
G
 
S
A
 
S
P
 
Y
G
 
K
D
 
S
Q
 
N
-
 
L
-
 
Q
-
 
D
-
 
I
-
 
F
R
 
R
I
 
V
W
 
K
L
 
C
R
 
S
V
 
V
N
 
N
D
 
G
E
 
Q
I
 
L
R
 
R
Q
 
Q
D
 
D
A
 
G
S
 
G
L
 
T
A
 
N
E
 
L
L
 
M
I
 
L
W
 
H
S
 
P
V
 
L
E
 
H
D
 
K
I
 
I
L
 
L
C
 
Q
H
 
H
L
 
I
S
 
S
L
 
T
Y
 
M
Y
 
I
H
 
S
L
 
L
R
 
E
P
 
P
G
 
G
D
 
D
L
 
I
V
 
I
M
 
L
T
 
T
G
 
G
T
 
T
P
 
P
A
 
A
G
 
G
V
 
V
G
 
G
P
 
E
V
 
L
V
 
K
A
 
P
G
 
G
D
 
D
D
 
R
I
 
V

6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
34% identity, 87% coverage: 23:221/229 of query aligns to 66:267/277 of 6iymA

query
sites
6iymA
W
 
L
P
 
P
I
 
P
G
 
R
R
 
N
I
 
V
F
 
I
C
 
C
V
 
V
G
 
G
R
 
K
N
 
N
Y
 
Y
A
 
A
A
 
D
H
 
H
A
 
I
A
 
K
E
 
E
M
 
M
G
 
D
V
 
T
E
 
-
V
 
A
D
 
G
R
 
A
E
 
G
Q
 
K
P
 
F
F
 
V
Y
 
L
F
 
F
T
 
T
K
 
K
S
 
A
A
 
P
C
 
S
H
 
S
A
 
I
V
 
V
L
 
-
S
 
-
G
 
G
A
 
P
E
 
F
V
 
D
P
 
P
-
 
I
-
 
E
-
 
R
Y
 
H
P
 
A
Q
 
D
G
 
L
T
 
T
E
 
Q
N
 
Q
F
 
L
H
 
D
H
 
Y
E
|
E
M
 
G
E
|
E
L
 
L
V
 
A
V
 
I
A
 
I
I
 
I
S
 
G
A
 
T
P
 
T
L
 
G
Q
 
R
D
 
D
A
 
L
T
 
T
V
 
P
A
 
E
Q
 
N
A
 
A
R
 
L
A
 
E
A
 
H
I
 
V
W
 
F
G
 
G
Y
 
Y
G
 
S
C
 
I
A
 
I
L
 
N
D
|
D
M
 
V
T
 
T
R
 
A
R
 
R
D
 
D
L
 
L
Q
 
Q
L
 
K
R
 
E
E
 
H
R
 
V
Q
 
Q
K
 
F
Q
 
F
R
 
R
P
 
-
W
 
-
S
 
-
L
 
-
G
 
G
K
 
K
D
 
S
L
 
L
E
 
D
N
 
G
G
 
F
S
 
C
V
 
P
F
 
F
A
 
G
P
 
P
L
 
V
R
 
I
A
 
V
A
 
T
E
 
E
D
 
D
W
 
A
G
 
F
A
 
D
P
 
P
G
 
A
D
 
D
Q
 
V
R
 
L
I
 
V
W
 
E
L
 
T
R
 
R
V
 
V
N
 
N
D
 
G
E
 
E
I
 
L
R
 
R
Q
 
Q
D
 
S
A
 
G
S
 
S
L
 
T
A
 
K
E
 
L
L
 
M
I
 
L
W
 
R
S
 
D
V
 
V
E
 
V
D
 
T
I
 
I
L
 
L
C
 
T
H
 
E
L
 
V
S
 
S
L
 
R
Y
 
G
Y
 
M
H
 
T
L
 
L
R
 
E
P
 
A
G
 
G
D
 
D
L
 
V
V
 
I
M
 
A
T
 
T
G
 
G
T
 
T
P
 
P
A
 
A
G
 
G
V
 
V
G
 
G
-
 
H
-
 
G
-
 
M
-
 
K
-
 
P
P
 
P
V
 
V
V
 
Y
A
 
L
-
 
Q
-
 
D
G
 
G
D
 
D
D
 
V
I
 
I
E
 
D
G
 
V
G
 
S
I
 
I
D
 
E
G
 
G
L
 
I

8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
31% identity, 95% coverage: 5:221/229 of query aligns to 56:271/290 of 8gstC

query
sites
8gstC
L
 
L
F
 
V
D
 
E
L
 
G
P
 
E
P
 
P
V
 
R
P
 
Y
A
 
G
I
 
V
P
 
P
V
 
V
E
 
K
G
 
G
R
 
-
D
 
-
E
 
-
S
 
-
W
 
-
P
 
-
I
 
I
G
 
G
R
 
K
I
 
I
F
 
V
C
 
A
V
x
I
G
|
G
R
x
L
N
 
N
Y
 
Y
A
 
E
A
 
D
H
|
H
A
 
A
A
 
I
E
 
E
M
 
S
G
 
N
V
 
L
E
 
P
V
 
I
D
 
P
R
 
T
E
 
E
Q
 
-
P
 
P
F
 
M
Y
 
M
F
|
F
T
 
M
K
 
K
S
 
A
A
 
L
C
 
S
H
 
S
A
 
L
V
 
N
L
 
G
S
 
P
G
 
N
A
 
D
E
 
E
V
 
V
P
 
V
Y
 
L
P
 
P
Q
 
K
G
 
N
T
 
S
E
 
T
N
 
H
F
 
G
H
 
D
H
 
W
E
|
E
M
 
V
E
|
E
L
 
L
V
 
G
V
 
V
A
 
V
I
 
I
S
 
G
A
 
E
P
 
T
L
 
C
Q
 
R
D
 
F
A
 
V
T
 
S
V
 
E
A
 
D
Q
 
E
A
 
A
R
 
L
A
 
S
A
 
K
I
 
V
W
 
A
G
 
G
Y
 
Y
G
 
V
C
 
L
A
 
V
L
 
N
D
|
D
M
 
V
T
 
S
R
 
E
R
 
R
D
 
-
L
 
-
Q
 
-
L
 
F
R
 
N
E
 
Q
R
 
K
Q
 
Q
K
 
R
Q
 
G
R
 
T
P
 
Q
W
 
W
S
 
S
L
 
K
G
 
G
K
|
K
D
 
G
L
 
H
E
 
D
N
 
T
G
 
F
S
 
C
V
 
P
F
 
V
A
 
G
P
 
P
-
 
W
L
 
L
R
 
V
A
 
T
A
 
P
E
 
D
D
 
E
W
 
V
G
 
G
A
 
D
P
 
P
G
 
Q
D
 
D
Q
 
L
R
 
D
I
 
V
W
 
H
L
 
L
R
 
D
V
 
V
N
 
N
D
 
G
E
 
E
I
 
R
R
 
M
Q
 
Q
D
 
T
A
 
G
S
 
N
L
 
T
A
 
K
E
 
T
L
 
M
I
 
I
W
 
F
S
 
N
V
 
V
E
 
A
D
 
Q
I
 
L
L
 
I
C
 
S
H
 
Y
L
 
V
S
 
S
L
 
E
Y
 
Y
Y
 
I
H
 
T
L
 
L
R
 
Y
P
 
P
G
 
G
D
 
D
L
 
L
V
 
M
M
 
I
T
 
T
G
|
G
T
|
T
P
 
P
A
 
P
G
 
G
V
 
V
G
 
G
P
 
E
-
 
G
-
 
K
-
 
K
-
 
P
-
 
Q
-
 
A
-
 
I
-
 
Y
V
 
L
V
 
K
A
 
A
G
 
G
D
 
D
D
 
V
I
 
M
E
 
E
G
 
L
G
 
G
I
 
I
D
 
E
G
 
K
L
 
L

8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
31% identity, 95% coverage: 5:221/229 of query aligns to 56:271/290 of 8gsrA

query
sites
8gsrA
L
 
L
F
 
V
D
 
E
L
 
G
P
 
E
P
 
P
V
 
R
P
 
Y
A
 
G
I
 
V
P
 
P
V
 
V
E
 
K
G
 
G
R
 
-
D
 
-
E
 
-
S
 
-
W
 
-
P
 
-
I
 
I
G
 
G
R
 
K
I
 
I
F
 
V
C
 
A
V
 
I
G
 
G
R
 
L
N
 
N
Y
 
Y
A
 
E
A
 
D
H
 
H
A
 
A
A
 
I
E
 
E
M
 
S
G
 
N
V
 
L
E
 
P
V
 
I
D
 
P
R
 
T
E
 
E
Q
 
-
P
 
P
F
 
M
Y
 
M
F
 
F
T
 
M
K
 
K
S
 
A
A
 
L
C
 
S
H
 
S
A
 
L
V
 
N
L
 
G
S
 
P
G
 
N
A
 
D
E
 
E
V
 
V
P
 
V
Y
 
L
P
 
P
Q
 
K
G
 
N
T
 
S
E
 
T
N
 
H
F
 
G
H
 
D
H
 
W
E
|
E
M
 
V
E
|
E
L
 
L
V
 
G
V
 
V
A
 
V
I
 
I
S
 
G
A
 
E
P
 
T
L
 
C
Q
 
R
D
 
F
A
 
V
T
 
S
V
 
E
A
 
D
Q
 
E
A
 
A
R
 
L
A
 
S
A
 
K
I
 
V
W
 
A
G
 
G
Y
 
Y
G
 
V
C
 
L
A
 
V
L
 
N
D
|
D
M
 
V
T
 
S
R
 
E
R
 
R
D
 
-
L
 
-
Q
 
-
L
 
F
R
 
N
E
 
Q
R
 
K
Q
 
Q
K
 
R
Q
 
G
R
 
T
P
 
Q
W
 
W
S
 
S
L
 
K
G
 
G
K
 
K
D
 
G
L
 
H
E
 
D
N
 
T
G
 
F
S
 
C
V
 
P
F
 
V
A
 
G
P
 
P
-
 
W
L
 
L
R
 
V
A
 
T
A
 
P
E
 
D
D
 
E
W
 
V
G
 
G
A
 
D
P
 
P
G
 
Q
D
 
D
Q
 
L
R
 
D
I
 
V
W
 
H
L
 
L
R
 
D
V
 
V
N
 
N
D
 
G
E
 
E
I
 
R
R
 
M
Q
 
Q
D
 
T
A
 
G
S
 
N
L
 
T
A
 
K
E
 
T
L
 
M
I
 
I
W
 
F
S
 
N
V
 
V
E
 
A
D
 
Q
I
 
L
L
 
I
C
 
S
H
 
Y
L
 
V
S
 
S
L
 
E
Y
 
Y
Y
 
I
H
 
T
L
 
L
R
 
Y
P
 
P
G
 
G
D
 
D
L
 
L
V
 
M
M
 
I
T
 
T
G
 
G
T
 
T
P
 
P
A
 
P
G
 
G
V
 
V
G
 
G
P
 
E
-
 
G
-
 
K
-
 
K
-
 
P
-
 
Q
-
 
A
-
 
I
-
 
Y
V
 
L
V
 
K
A
 
A
G
 
G
D
 
D
D
 
V
I
 
M
E
 
E
G
 
L
G
 
G
I
 
I
D
 
E
G
 
K
L
 
L

3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
30% identity, 85% coverage: 27:221/229 of query aligns to 63:240/252 of 3qdfA

query
sites
3qdfA
R
 
K
I
 
V
F
 
V
C
 
C
V
 
V
G
 
G
R
 
K
N
 
N
Y
 
Y
A
 
T
A
 
P
H
 
-
A
 
-
A
 
-
E
 
-
M
 
-
G
 
-
V
 
-
E
 
-
V
 
-
D
 
-
R
 
-
E
 
A
Q
 
D
P
 
P
F
 
V
Y
 
I
F
 
F
T
 
L
K
 
K
S
 
P
A
 
N
C
 
T
H
 
A
A
 
I
V
 
V
L
 
G
S
 
P
G
 
N
A
 
V
E
 
P
V
 
I
P
 
R
Y
 
L
P
 
P
Q
 
A
G
 
N
T
 
A
E
 
S
N
 
P
F
 
V
H
 
H
H
 
F
E
|
E
M
 
G
E
|
E
L
 
L
V
 
A
V
 
I
A
 
V
I
 
I
S
 
G
A
 
R
P
 
P
L
 
C
Q
 
K
D
 
D
A
 
V
T
 
S
V
 
A
A
 
A
Q
 
Q
A
 
A
R
 
V
A
 
D
A
 
N
I
 
I
W
 
L
G
 
G
Y
 
Y
G
 
T
C
 
I
A
 
G
L
 
N
D
|
D
M
 
V
T
 
S
R
 
A
R
 
R
D
 
D
L
 
Q
Q
 
Q
L
 
K
R
 
S
E
 
D
R
 
G
Q
 
Q
K
 
-
Q
 
-
R
 
-
P
 
-
W
 
W
S
 
T
L
 
R
G
 
A
K
 
K
D
 
G
L
 
H
E
 
D
N
 
T
G
 
F
S
 
C
V
 
P
F
 
V
A
 
G
P
 
P
L
 
W
R
 
I
A
 
V
A
 
T
E
 
D
D
 
V
W
 
-
G
 
-
A
 
D
P
 
P
G
 
A
D
 
D
Q
 
L
R
x
E
I
 
L
W
 
R
L
 
T
R
 
E
V
 
V
N
 
N
D
 
G
E
 
A
I
 
V
R
 
K
Q
 
Q
D
x
H
A
 
A
S
 
R
L
 
T
A
 
S
E
 
L
L
 
M
I
 
I
W
 
H
S
 
D
V
 
V
E
 
G
D
 
A
I
 
I
L
 
V
C
 
E
H
 
W
L
 
I
S
 
S
L
 
A
Y
 
V
Y
 
M
H
 
T
L
 
L
R
 
L
P
 
P
G
 
G
D
 
D
L
 
L
V
 
I
M
 
L
T
 
T
G
 
G
T
 
T
P
 
P
A
 
A
G
 
G
V
 
V
G
 
G
P
 
P
V
 
I
V
 
E
A
 
D
G
 
G
D
 
D
D
 
T
I
 
V
E
 
S
G
 
I
G
 
T
I
 
I
D
 
E
G
 
G
L
 
I

6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
32% identity, 79% coverage: 27:206/229 of query aligns to 71:246/279 of 6v77B

query
sites
6v77B
R
 
Q
I
 
V
F
 
F
C
 
A
V
 
V
G
 
G
R
 
L
N
 
N
Y
 
Y
A
 
D
A
 
D
H
 
H
A
 
A
A
 
T
E
 
E
M
 
S
G
 
G
V
 
L
E
 
S
V
 
-
D
 
K
R
 
P
E
 
E
Q
 
H
P
 
P
F
 
V
Y
 
I
F
 
F
T
 
T
K
 
K
S
 
F
A
 
V
C
 
S
H
 
S
A
 
I
V
 
T
L
 
G
S
 
P
G
 
V
A
 
E
E
 
T
V
 
V
P
 
Q
Y
 
L
P
 
P
Q
 
A
G
 
G
T
 
S
E
 
V
N
 
D
F
 
W
H
 
-
H
 
-
E
|
E
M
 
V
E
|
E
L
 
L
V
 
V
V
 
V
A
 
V
I
 
M
S
 
G
A
 
R
P
 
G
L
 
G
Q
 
R
D
 
N
A
 
I
T
 
P
V
 
E
A
 
D
Q
 
R
A
 
A
R
 
W
A
 
E
A
 
F
I
 
V
W
 
A
G
 
G
Y
 
V
G
 
S
C
 
V
A
 
G
L
 
Q
D
|
D
M
 
L
T
 
S
R
 
E
R
 
R
D
 
D
L
 
L
Q
 
Q
L
 
L
R
 
A
E
 
G
R
 
P
Q
 
A
K
 
P
Q
 
Q
R
 
-
P
 
-
W
 
F
S
 
S
L
 
L
G
 
A
K
 
K
D
 
S
L
 
H
E
 
A
N
 
G
G
 
F
S
 
S
V
 
P
F
 
I
A
 
G
P
 
P
-
 
E
L
 
L
R
 
V
A
 
T
A
 
V
E
 
D
D
 
E
W
 
L
G
 
P
A
 
D
P
 
P
G
 
D
D
 
D
Q
 
L
R
 
E
I
 
L
W
 
G
L
 
A
R
 
E
V
 
I
N
 
N
D
 
G
E
 
E
I
 
T
R
 
V
Q
 
Q
D
 
H
A
 
S
S
 
R
L
 
T
A
 
S
E
 
Q
L
 
L
I
 
I
W
 
F
S
 
P
V
 
V
E
 
S
D
 
N
I
 
L
L
 
I
C
 
A
H
 
Y
L
 
L
S
 
S
L
 
D
Y
 
T
Y
 
V
H
 
E
L
 
L
R
 
Y
P
 
P
G
 
G
D
 
D
L
 
V
V
 
I
M
 
F
T
 
T
G
 
G
T
 
T
P
 
P
A
 
S
G
 
G
V
 
V
G
 
G

1gttA Crystal structure of hpce (see paper)
32% identity, 80% coverage: 24:206/229 of query aligns to 221:392/421 of 1gttA

query
sites
1gttA
P
 
P
I
 
H
G
 
G
R
 
T
I
 
L
F
 
F
C
 
A
V
 
L
G
 
G
R
 
L
N
 
N
Y
 
Y
A
 
A
A
 
D
H
 
H
A
 
P
A
 
-
E
 
-
M
 
-
G
 
-
V
 
-
E
 
-
V
 
-
D
 
-
R
 
-
E
 
E
Q
 
E
P
 
P
F
 
L
Y
 
V
F
 
F
T
 
L
K
 
K
S
 
A
A
 
P
C
 
N
H
 
T
A
 
L
V
 
T
L
 
G
S
 
D
G
 
N
A
 
Q
E
 
T
V
 
S
P
 
V
Y
 
R
P
 
P
Q
 
N
G
 
N
T
 
I
E
 
E
N
 
Y
F
 
M
H
 
H
H
 
Y
E
|
E
M
 
A
E
|
E
L
 
L
V
 
V
V
 
V
A
 
V
I
 
I
S
 
G
A
 
K
P
 
Q
L
 
A
Q
 
R
D
 
N
A
 
V
T
 
S
V
 
E
A
 
A
Q
 
D
A
 
A
R
 
M
A
 
D
A
 
Y
I
 
V
W
 
A
G
 
G
Y
 
Y
G
 
T
C
 
V
A
 
C
L
 
N
D
|
D
M
 
Y
T
 
A
R
 
I
R
 
R
D
 
D
-
 
Y
L
 
L
Q
 
E
L
 
N
R
 
Y
E
 
Y
R
 
R
Q
 
P
K
 
N
Q
 
L
R
 
R
P
 
V
W
 
K
S
 
S
L
 
R
G
 
D
K
 
G
D
 
L
L
 
T
E
 
P
N
 
M
G
 
L
S
 
S
V
 
T
F
 
I
A
 
V
P
 
P
L
 
K
R
 
E
A
 
A
A
 
I
E
 
P
D
 
D
W
 
-
G
 
-
A
 
-
P
 
P
G
 
H
D
 
N
Q
 
L
R
 
T
I
 
L
W
 
R
L
 
T
R
 
F
V
 
V
N
 
N
D
 
G
E
 
E
I
 
L
R
 
R
Q
 
Q
D
 
Q
A
 
G
S
 
T
L
 
T
A
 
A
E
 
D
L
 
L
I
 
I
W
 
F
S
 
S
V
 
V
E
 
P
D
 
F
I
 
L
L
 
I
C
 
A
H
 
Y
L
 
L
S
 
S
L
 
E
Y
 
F
Y
 
M
H
 
T
L
 
L
R
 
N
P
 
P
G
 
G
D
 
D
L
 
M
V
 
I
M
 
A
T
 
T
G
 
G
T
 
T
P
 
P
A
 
K
G
 
G
V
 
L
G
 
S

6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
31% identity, 86% coverage: 23:219/229 of query aligns to 75:251/264 of 6jvwB

query
sites
6jvwB
W
 
W
P
 
P
I
 
-
G
 
N
R
 
K
I
 
I
F
 
I
C
 
A
V
x
Y
G
x
P
R
x
V
N
 
N
Y
 
Y
A
 
H
A
 
A
H
 
H
A
 
G
A
 
-
E
 
-
M
 
-
G
 
-
V
 
-
E
 
-
V
 
-
D
 
-
R
 
-
E
 
N
Q
 
Q
P
 
G
F
 
F
Y
x
F
F
 
L
T
 
K
K
 
P
-
 
G
S
 
S
A
 
A
C
 
L
H
 
S
A
 
G
V
 
P
L
 
T
S
 
D
G
 
P
A
 
V
E
 
V
V
 
L
P
 
P
Y
 
A
P
 
V
Q
 
P
G
 
G
T
 
R
E
 
E
N
 
-
F
 
V
H
 
H
H
 
H
E
|
E
M
 
S
E
|
E
L
 
L
V
 
A
V
 
I
A
 
I
I
 
I
S
 
G
A
 
K
P
 
T
L
 
C
Q
 
R
D
 
S
A
 
V
T
 
A
V
 
R
A
 
E
Q
 
D
A
 
W
R
 
K
A
 
D
A
 
V
I
 
V
W
 
F
G
 
G
Y
 
Y
G
 
A
C
 
C
A
 
L
L
 
L
D
|
D
M
 
M
T
 
V
R
 
V
R
 
R
D
 
G
L
 
R
Q
 
V
L
 
F
R
 
R
E
x
K
R
 
A
Q
 
Y
K
 
D
Q
 
T
-
 
F
-
 
C
-
 
P
-
 
V
R
 
G
P
 
P
W
 
W
S
 
I
L
 
T
G
 
T
K
 
A
D
 
D
L
 
A
E
 
V
N
 
N
G
 
D
S
 
P
V
 
-
F
 
-
A
 
-
P
 
-
L
 
-
R
 
-
A
 
-
A
 
-
E
 
-
D
 
-
W
 
-
G
 
-
A
 
A
P
 
T
G
 
L
D
 
D
Q
 
M
R
 
K
I
 
L
W
 
W
L
 
-
R
 
-
V
 
V
N
 
N
D
 
D
E
 
D
I
 
L
R
 
R
Q
 
Q
D
 
K
A
 
A
S
 
N
L
 
T
A
 
R
E
 
D
L
 
L
I
 
V
W
 
L
S
 
D
V
 
I
E
 
P
D
 
G
I
 
M
L
 
I
C
 
A
H
 
T
L
 
A
S
 
S
L
 
A
Y
 
V
Y
 
M
H
 
T
L
 
L
R
 
Q
P
 
P
G
 
G
D
 
D
L
 
I
V
 
I
M
 
A
T
 
T
G
|
G
T
|
T
P
 
P
A
 
E
G
 
G
V
 
V
G
 
G
P
 
P
V
 
V
V
 
V
A
 
D
G
 
G
D
 
D
D
 
R
I
 
I
E
 
R
G
 
I
G
 
V
I
 
I
D
 
D

6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
31% identity, 79% coverage: 27:206/229 of query aligns to 69:247/280 of 6j5xB

query
sites
6j5xB
R
 
K
I
 
I
F
 
V
C
 
C
V
|
V
G
|
G
R
x
L
N
 
N
Y
 
Y
A
 
A
A
 
N
H
|
H
A
 
I
A
 
K
E
 
E
M
 
M
G
 
G
V
 
R
E
 
D
V
 
L
D
 
P
R
 
-
E
 
D
Q
 
T
P
 
P
F
 
T
Y
 
L
F
|
F
T
 
V
K
 
K
S
 
F
A
 
P
C
 
D
H
 
A
A
 
L
V
 
I
L
 
G
S
 
P
G
 
F
A
 
D
E
 
D
V
 
V
P
 
V
Y
 
V
P
 
P
Q
 
E
-
 
W
G
 
A
T
 
N
E
 
K
N
 
A
F
 
L
H
 
D
H
 
W
E
|
E
M
 
G
E
|
E
L
 
M
V
 
A
V
 
V
A
 
I
I
 
I
S
 
G
A
 
K
P
 
R
L
 
A
Q
 
R
D
 
R
A
 
V
T
 
K
V
 
Q
A
 
A
Q
 
D
A
 
A
R
 
A
A
 
E
A
 
Y
I
 
I
W
 
A
G
 
G
Y
 
Y
G
 
A
C
 
V
A
 
M
L
 
N
D
|
D
M
 
Y
T
 
T
R
 
T
R
 
R
D
 
D
L
 
F
Q
 
Q
L
 
Y
R
 
A
E
 
A
R
 
P
Q
 
A
K
 
K
Q
 
T
R
 
P
P
 
Q
W
|
W
S
 
H
L
 
Q
G
 
G
K
|
K
D
 
S
L
 
L
E
 
E
N
 
K
G
 
S
S
 
A
V
 
G
F
 
F
A
 
G
P
 
P
L
 
W
R
 
M
A
 
T
A
 
T
E
 
P
D
 
D
W
 
S
G
 
F
A
 
E
P
 
F
G
 
G
D
 
G
Q
 
E
R
 
-
I
 
L
W
 
A
L
 
T
R
 
Y
V
 
L
N
 
E
D
 
G
E
 
E
I
 
K
R
 
V
Q
 
Q
D
 
S
A
 
T
S
 
P
L
 
T
A
 
N
E
 
D
L
 
L
I
 
V
W
 
F
S
 
S
V
 
P
E
 
E
D
 
K
I
 
L
L
 
I
C
 
E
H
 
Y
L
 
I
S
 
T
L
 
H
Y
 
I
Y
 
Y
H
 
P
L
 
L
R
 
D
P
 
A
G
 
G
D
 
D
L
 
V
V
 
I
M
 
V
T
 
T
G
|
G
T
|
T
P
 
P
A
 
G
G
 
G
V
 
V
G
 
G

6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
31% identity, 79% coverage: 27:206/229 of query aligns to 69:247/280 of 6j5xA

query
sites
6j5xA
R
 
K
I
 
I
F
 
V
C
 
C
V
 
V
G
 
G
R
 
L
N
 
N
Y
 
Y
A
 
A
A
 
N
H
 
H
A
 
I
A
 
K
E
 
E
M
 
M
G
 
G
V
 
R
E
 
D
V
 
L
D
 
P
R
 
-
E
 
D
Q
 
T
P
 
P
F
 
T
Y
 
L
F
 
F
T
 
V
K
 
K
S
 
F
A
 
P
C
 
D
H
 
A
A
 
L
V
 
I
L
 
G
S
 
P
G
 
F
A
 
D
E
 
D
V
 
V
P
 
V
Y
 
V
P
 
P
Q
 
E
-
 
W
G
 
A
T
 
N
E
 
K
N
 
A
F
 
L
H
 
D
H
 
W
E
|
E
M
 
G
E
|
E
L
 
M
V
 
A
V
 
V
A
 
I
I
 
I
S
 
G
A
 
K
P
 
R
L
 
A
Q
 
R
D
 
R
A
 
V
T
 
K
V
 
Q
A
 
A
Q
 
D
A
 
A
R
 
A
A
 
E
A
 
Y
I
 
I
W
 
A
G
 
G
Y
 
Y
G
 
A
C
 
V
A
 
M
L
 
N
D
|
D
M
 
Y
T
 
T
R
 
T
R
 
R
D
 
D
L
 
F
Q
 
Q
L
 
Y
R
 
A
E
 
A
R
 
P
Q
 
A
K
 
K
Q
 
T
R
 
P
P
 
Q
W
 
W
S
 
H
L
 
Q
G
 
G
K
 
K
D
 
S
L
 
L
E
 
E
N
 
K
G
 
S
S
 
A
V
 
G
F
 
F
A
 
G
P
 
P
L
 
W
R
 
M
A
 
T
A
 
T
E
 
P
D
 
D
W
 
S
G
 
F
A
 
E
P
 
F
G
 
G
D
 
G
Q
 
E
R
 
-
I
 
L
W
 
A
L
 
T
R
 
Y
V
 
L
N
 
E
D
 
G
E
 
E
I
 
K
R
 
V
Q
 
Q
D
 
S
A
 
T
S
 
P
L
 
T
A
 
N
E
 
D
L
 
L
I
 
V
W
 
F
S
 
S
V
 
P
E
 
E
D
 
K
I
 
L
L
 
I
C
 
E
H
 
Y
L
 
I
S
 
T
L
 
H
Y
 
I
Y
 
Y
H
 
P
L
 
L
R
 
D
P
 
A
G
 
G
D
 
D
L
 
V
V
 
I
M
 
V
T
 
T
G
 
G
T
 
T
P
 
P
A
 
G
G
 
G
V
 
V
G
 
G

4dbhA Crystal structure of cg1458 with inhibitor (see paper)
25% identity, 85% coverage: 27:221/229 of query aligns to 63:259/269 of 4dbhA

query
sites
4dbhA
R
 
K
I
 
V
F
 
V
C
 
A
V
x
I
G
|
G
R
|
R
N
 
N
Y
 
Y
A
 
A
A
 
D
H
|
H
A
 
V
A
 
A
E
 
E
M
 
V
-
 
F
G
 
K
V
 
K
E
 
S
V
 
A
D
 
E
R
 
S
E
 
L
Q
 
P
P
 
P
F
 
T
Y
 
L
F
|
F
T
 
L
K
 
K
S
 
P
A
 
P
C
 
T
H
 
A
A
 
V
V
 
T
L
 
G
S
 
P
G
 
E
A
 
S
E
 
P
V
 
I
P
 
R
Y
 
I
P
 
P
Q
 
S
G
 
F
T
 
A
E
 
T
N
 
K
F
 
V
H
 
E
H
 
F
E
|
E
M
 
G
E
|
E
L
 
L
V
 
A
V
 
V
A
 
V
I
 
I
S
 
G
A
 
K
P
 
P
L
 
C
Q
 
K
D
 
N
A
 
V
T
 
K
V
 
A
A
 
D
Q
 
D
A
 
W
R
 
K
A
 
S
A
 
V
I
 
V
W
 
L
G
 
G
Y
 
F
G
 
T
C
 
I
A
 
I
L
 
N
D
|
D
M
 
V
T
 
S
R
 
S
R
 
R
D
 
D
L
 
L
Q
 
Q
L
 
F
R
 
A
E
 
D
R
 
G
Q
 
Q
K
 
-
Q
 
-
R
 
-
P
 
-
W
 
W
S
 
A
L
 
R
G
 
A
K
|
K
D
 
G
L
 
I
E
 
D
N
 
T
G
 
F
S
 
G
V
 
P
F
 
I
A
 
G
P
 
P
-
 
W
-
 
I
-
 
E
-
 
T
-
 
D
L
 
I
R
 
N
A
 
S
A
 
I
E
 
D
D
 
L
W
 
D
G
 
N
A
 
L
P
 
P
G
 
I
D
 
K
Q
 
A
R
 
R
I
 
L
W
 
T
L
 
H
R
 
D
V
 
G
N
 
E
D
 
T
E
 
Q
I
 
L
R
 
K
Q
 
Q
D
 
D
A
 
S
S
 
N
L
 
S
A
 
N
E
 
Q
L
 
M
I
 
I
W
 
M
S
 
K
V
 
M
E
 
G
D
 
E
I
 
I
L
 
I
C
 
E
H
 
F
L
 
I
S
 
T
L
 
A
Y
 
S
Y
 
M
H
 
T
L
 
L
R
 
L
P
 
P
G
 
G
D
 
D
L
 
V
V
 
I
M
 
A
T
 
T
G
|
G
T
x
S
P
 
P
A
 
A
G
 
G
V
 
T
G
 
E
P
 
A
V
 
M
V
 
V
A
 
D
G
 
G
D
 
D
D
 
Y
I
 
I
E
 
E
G
 
I
G
 
E
I
 
I
D
 
P
G
 
G
L
 
I

3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
26% identity, 79% coverage: 26:206/229 of query aligns to 63:231/265 of 3r6oA

query
sites
3r6oA
G
 
G
R
 
Q
I
 
V
F
 
I
C
 
A
V
 
L
G
 
G
R
 
F
N
 
N
Y
 
Y
A
 
P
A
 
T
H
 
H
A
 
-
A
 
-
E
 
-
M
 
-
G
 
-
V
 
-
E
 
-
V
 
-
D
 
-
R
 
-
E
 
-
Q
 
D
P
 
P
F
 
V
Y
 
V
F
 
F
T
 
M
K
 
K
S
 
S
A
 
P
C
 
T
H
 
S
A
 
I
V
 
S
L
 
G
S
 
P
G
 
R
A
 
D
E
 
A
V
 
V
P
 
I
Y
 
A
P
 
P
Q
 
R
G
 
T
T
 
S
E
 
H
N
 
A
F
 
L
H
 
D
H
 
Y
E
|
E
M
 
I
E
|
E
L
 
I
V
 
A
V
 
V
A
 
V
I
 
I
S
 
G
A
 
K
P
 
P
L
 
G
Q
 
Y
D
 
R
A
 
I
T
 
E
V
 
R
A
 
S
Q
 
Q
A
 
A
R
 
I
A
 
K
A
 
H
I
 
V
W
 
A
G
 
G
Y
 
Y
G
 
M
C
 
L
A
 
A
L
 
N
D
|
D
M
 
I
T
 
T
R
 
A
R
 
R
D
 
D
L
 
V
Q
 
A
L
 
L
R
 
P
E
 
F
R
 
G
Q
 
Q
K
 
A
Q
 
Q
R
 
-
P
 
-
W
 
-
S
 
-
L
 
-
G
 
-
K
 
-
D
 
-
L
 
V
E
 
V
N
 
R
G
 
G
S
 
K
V
 
G
F
 
Y
A
 
P
P
 
T
L
 
F
R
 
C
A
 
P
A
 
T
E
 
G
D
 
P
W
 
W
-
 
L
G
 
F
A
 
T
P
 
T
G
 
G
D
 
S
Q
 
D
R
 
T
I
 
T
W
 
F
-
 
E
-
 
T
-
 
F
-
 
D
-
 
F
-
 
E
L
 
L
R
 
R
V
 
I
N
 
N
D
 
G
E
 
E
I
 
L
R
 
R
Q
 
Q
D
 
S
A
 
G
S
 
S
L
 
T
A
 
V
E
 
D
L
 
M
I
 
T
W
 
L
S
 
G
V
 
F
E
 
A
D
 
E
I
 
V
L
 
V
C
 
E
H
 
T
L
 
V
S
 
S
L
 
A
Y
 
T
Y
 
I
H
 
A
L
 
L
R
 
R
P
 
A
G
 
G
D
 
D
L
 
I
V
 
I
M
 
L
T
 
T
G
 
G
T
 
T
P
 
P
A
 
G
G
 
G
V
 
C
G
 
G

Query Sequence

>GFF3340 FitnessBrowser__Phaeo:GFF3340
MSKVLFDLPPVPAIPVEGRDESWPIGRIFCVGRNYAAHAAEMGVEVDREQPFYFTKSACH
AVLSGAEVPYPQGTENFHHEMELVVAISAPLQDATVAQARAAIWGYGCALDMTRRDLQLR
ERQKQRPWSLGKDLENGSVFAPLRAAEDWGAPGDQRIWLRVNDEIRQDASLAELIWSVED
ILCHLSLYYHLRPGDLVMTGTPAGVGPVVAGDDIEGGIDGLMPVRLALR

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory