SitesBLAST
Comparing GFF3369 FitnessBrowser__Phaeo:GFF3369 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8sgsA Short-chain specific acyl-CoA dehydrogenase, mitochondrial (see paper)
41% identity, 98% coverage: 5:384/387 of query aligns to 4:379/381 of 8sgsA
- binding coenzyme a: S131 (= S132), A133 (≠ L134), N177 (≠ P178), F231 (= F236), M235 (≠ N240), L238 (= L243), I312 (≠ E317), E362 (= E367), G363 (= G368)
- binding flavin-adenine dinucleotide: F122 (≠ L123), L124 (≠ M125), S125 (≠ T126), G130 (= G131), S131 (= S132), W155 (≠ F156), T157 (≠ S158), R267 (= R272), F270 (= F275), L274 (≠ I279), L277 (≠ F282), Q335 (= Q340), I336 (= I341), G338 (= G343), G339 (= G344), I357 (≠ V362), I360 (= I365), Y361 (≠ W366), T364 (= T369), E366 (= E371)
7y0bA Crystal structure of human short-chain acyl-coa dehydrogenase
41% identity, 98% coverage: 5:384/387 of query aligns to 7:382/385 of 7y0bA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[[4-[(3S)-oxolan-3-yl]oxyphenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: M343 (= M345), T347 (≠ D349), E348 (= E350)
- binding flavin-adenine dinucleotide: F125 (≠ L123), L127 (≠ M125), S128 (≠ T126), G133 (= G131), S134 (= S132), W158 (≠ F156), T160 (≠ S158), R270 (= R272), F273 (= F275), L280 (≠ F282), V282 (≠ G284), Q338 (= Q340), I339 (= I341), G342 (= G344), I360 (≠ V362), Y364 (≠ W366), T367 (= T369), E369 (= E371), I370 (= I372), L373 (≠ H375)
7y0aC Crystal structure of human short-chain acyl-coa dehydrogenase
41% identity, 98% coverage: 5:384/387 of query aligns to 10:385/387 of 7y0aC
- binding flavin-adenine dinucleotide: F128 (≠ L123), L130 (≠ M125), S131 (≠ T126), G136 (= G131), S137 (= S132), W161 (≠ F156), T163 (≠ S158), T214 (≠ N213), R273 (= R272), F276 (= F275), L280 (≠ I279), L283 (≠ F282), V285 (≠ G284), Q341 (= Q340), I342 (= I341), G345 (= G344), I363 (≠ V362), Y367 (≠ W366), T370 (= T369), E372 (= E371), L376 (≠ H375)
P16219 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Homo sapiens (Human) (see 3 papers)
41% identity, 98% coverage: 5:384/387 of query aligns to 34:409/412 of P16219
- G90 (= G65) to S: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908005
- E104 (= E79) natural variant: Missing (in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs387906308)
- 152:161 (vs. 123:132, 60% identical) binding in other chain
- R171 (= R142) to W: 69% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1800556
- WIT 185:187 (≠ FIS 156:158) binding in other chain
- A192 (= A163) to V: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940874
- G209 (= G180) to S: 86% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1799958
- R297 (= R272) binding
- Q308 (= Q283) binding in other chain
- R325 (≠ N300) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908006
- S353 (≠ T328) to L: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28941773
- QILGG 365:369 (≠ QIHGG 340:344) binding
- R380 (= R355) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940875
- TSE 394:396 (= TSE 369:371) binding in other chain
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
2vigB Crystal structure of human short-chain acyl coa dehydrogenase
41% identity, 98% coverage: 5:384/387 of query aligns to 1:369/371 of 2vigB
- active site: L121 (≠ M125), S122 (≠ T126), G231 (≠ T246), E352 (= E367), G364 (≠ R379)
- binding coenzyme a persulfide: S128 (= S132), F221 (= F236), M225 (≠ N240), Q226 (≠ T241), L228 (= L243), D229 (≠ G244), R232 (= R247), E352 (= E367), G353 (= G368), I357 (= I372)
- binding flavin-adenine dinucleotide: L121 (≠ M125), S122 (≠ T126), G127 (= G131), S128 (= S132), W152 (≠ F156), T154 (≠ S158), R257 (= R272), F260 (= F275), L264 (≠ I279), L267 (≠ F282), Q325 (= Q340), I326 (= I341), G329 (= G344), I347 (≠ V362), Y351 (≠ W366), T354 (= T369), E356 (= E371)
6fahD Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
40% identity, 98% coverage: 5:383/387 of query aligns to 3:378/379 of 6fahD
- active site: L124 (≠ M125), T125 (= T126), G241 (≠ T246), G374 (≠ R379)
- binding flavin-adenine dinucleotide: F122 (≠ L123), L124 (≠ M125), T125 (= T126), R152 (≠ T153), F155 (= F156), T157 (≠ S158), E198 (≠ Y203), R267 (= R272), Q269 (= Q274), F270 (= F275), I274 (= I279), F277 (= F282), Q335 (= Q340), I336 (= I341), G339 (= G344), Y361 (≠ W366), T364 (= T369), Q366 (≠ E371)
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
39% identity, 98% coverage: 6:383/387 of query aligns to 5:378/378 of 5ol2F
- active site: L124 (≠ M125), T125 (= T126), G241 (≠ T246), G374 (≠ R379)
- binding calcium ion: E29 (= E30), E33 (≠ S34), R35 (≠ H36)
- binding coenzyme a persulfide: L238 (= L243), R242 (= R247), E362 (= E367), G363 (= G368)
- binding flavin-adenine dinucleotide: F122 (≠ L123), L124 (≠ M125), T125 (= T126), P127 (= P128), T131 (≠ S132), F155 (= F156), I156 (= I157), T157 (≠ S158), E198 (≠ Y203), R267 (= R272), F270 (= F275), L274 (≠ I279), F277 (= F282), Q335 (= Q340), L336 (≠ I341), G338 (= G343), G339 (= G344), Y361 (≠ W366), T364 (= T369), E366 (= E371)
1jqiA Crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa (see paper)
39% identity, 98% coverage: 5:384/387 of query aligns to 7:382/384 of 1jqiA
- active site: G377 (≠ R379)
- binding acetoacetyl-coenzyme a: L95 (vs. gap), F125 (≠ L123), S134 (= S132), F234 (= F236), M238 (≠ N240), Q239 (≠ T241), L241 (= L243), D242 (≠ G244), R245 (= R247), Y364 (≠ W366), E365 (= E367), G366 (= G368)
- binding flavin-adenine dinucleotide: F125 (≠ L123), L127 (≠ M125), S128 (≠ T126), G133 (= G131), S134 (= S132), W158 (≠ F156), T160 (≠ S158), R270 (= R272), F273 (= F275), L280 (≠ F282), Q338 (= Q340), I339 (= I341), G342 (= G344), I360 (≠ V362), T367 (= T369), E369 (= E371), I370 (= I372)
P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Rattus norvegicus (Rat) (see 2 papers)
39% identity, 98% coverage: 5:384/387 of query aligns to 34:409/412 of P15651
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
37% identity, 99% coverage: 1:384/387 of query aligns to 1:379/379 of 1ukwB
- active site: L124 (≠ M125), S125 (≠ T126), T241 (= T246), E362 (= E367), R374 (= R379)
- binding cobalt (ii) ion: D145 (= D146), H146 (≠ E147)
- binding flavin-adenine dinucleotide: F122 (≠ L123), L124 (≠ M125), S125 (≠ T126), G130 (= G131), S131 (= S132), W155 (≠ F156), S157 (= S158), K200 (≠ N205), L357 (≠ V362), Y361 (≠ W366), E362 (= E367), T364 (= T369), E366 (= E371), L370 (≠ H375)
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
37% identity, 99% coverage: 1:384/387 of query aligns to 1:379/379 of 1ukwA
- active site: L124 (≠ M125), S125 (≠ T126), T241 (= T246), E362 (= E367), R374 (= R379)
- binding flavin-adenine dinucleotide: F122 (≠ L123), L124 (≠ M125), S125 (≠ T126), G130 (= G131), S131 (= S132), W155 (≠ F156), S157 (= S158), L357 (≠ V362), Y361 (≠ W366), E362 (= E367), T364 (= T369), E366 (= E371), L370 (≠ H375)
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
38% identity, 97% coverage: 7:382/387 of query aligns to 4:373/374 of 5lnxD
- active site: L122 (≠ M125), T123 (= T126), G239 (≠ T246), E358 (= E367), K370 (≠ R379)
- binding flavin-adenine dinucleotide: L122 (≠ M125), T123 (= T126), G128 (= G131), S129 (= S132), F153 (= F156), T155 (≠ S158), R265 (= R272), Q267 (= Q274), F268 (= F275), I272 (= I279), N275 (≠ F282), I278 (≠ V285), Q331 (= Q340), I332 (= I341), G335 (= G344), Y357 (≠ W366), T360 (= T369), E362 (= E371)
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
39% identity, 99% coverage: 1:383/387 of query aligns to 1:379/380 of 4l1fA
- active site: L125 (≠ M125), T126 (= T126), G242 (≠ T246), E363 (= E367), R375 (= R379)
- binding coenzyme a persulfide: T132 (≠ S132), H179 (≠ R179), F232 (= F236), M236 (≠ N240), E237 (≠ T241), L239 (= L243), D240 (≠ G244), R243 (= R247), Y362 (≠ W366), E363 (= E367), G364 (= G368), R375 (= R379)
- binding flavin-adenine dinucleotide: F123 (≠ L123), L125 (≠ M125), T126 (= T126), G131 (= G131), T132 (≠ S132), F156 (= F156), I157 (= I157), T158 (≠ S158), R268 (= R272), Q270 (= Q274), F271 (= F275), I275 (= I279), F278 (= F282), L281 (≠ V285), Q336 (= Q340), I337 (= I341), G340 (= G344), I358 (≠ V362), Y362 (≠ W366), T365 (= T369), Q367 (≠ E371)
- binding 1,3-propandiol: L5 (= L5), Q10 (≠ S10)
Q9VSA3 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial; EC 1.3.8.7 from Drosophila melanogaster (Fruit fly) (see paper)
36% identity, 99% coverage: 3:387/387 of query aligns to 35:417/419 of Q9VSA3
- S347 (≠ E317) modified: Phosphoserine; by Pink1; mutation to A: Prevents phosphorylation by Pink1. Does not rescue climbing and flight defects in Pink1 mutants.; mutation to D: Phosphomimetic mutant that fully rescues climbing defects and significantly improves flight defects, and thorax and wing posture phenotypes in Pink1 mutants. No effect on acyl-CoA dehydrogenase activity.; mutation to DD: Phosphomimetic mutant that fully rescues climbing defects and significantly improves flight defects, and thorax and wing posture phenotypes in Pink1 mutants. No effect on acyl-CoA dehydrogenase activity.
1ivhA Structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity (see paper)
37% identity, 97% coverage: 4:379/387 of query aligns to 7:382/387 of 1ivhA
- active site: M130 (= M125), S131 (≠ T126), E249 (≠ T246), A370 (≠ E367), R382 (= R379)
- binding coenzyme a persulfide: S137 (= S132), S185 (≠ K182), R186 (≠ K183), V239 (≠ F236), Y240 (≠ D237), M243 (≠ N240), E249 (≠ T246), R250 (= R247), G369 (≠ W366), A370 (≠ E367), G371 (= G368), V375 (≠ I372)
- binding flavin-adenine dinucleotide: L128 (= L123), M130 (= M125), S131 (≠ T126), G136 (= G131), S137 (= S132), W161 (≠ F156), T163 (≠ S158), R275 (= R272), F278 (= F275), F285 (= F282), M288 (≠ V285), Q343 (= Q340), C344 (≠ I341), G347 (= G344), T372 (= T369), E374 (= E371)
4iv6B X-ray crystal structure of an isovaleryl-coa dehydrogenase from mycobacterium smegmatis (see paper)
37% identity, 99% coverage: 5:387/387 of query aligns to 2:380/383 of 4iv6B
- active site: L121 (≠ M125), T122 (= T126), G240 (≠ T246), E361 (= E367), K373 (≠ R379)
- binding dihydroflavine-adenine dinucleotide: L121 (≠ M125), T122 (= T126), G126 (≠ A130), G127 (= G131), S128 (= S132), W152 (≠ F156), I153 (= I157), S154 (= S158), R266 (= R272), S268 (≠ Q274), F269 (= F275), I273 (= I279), H276 (≠ F282), V279 (= V285), R334 (≠ Q340), V335 (≠ I341), G338 (= G344), L356 (≠ V362), G360 (≠ W366), T363 (= T369), E365 (= E371), I366 (= I372)
8sgrA Isovaleryl-CoA dehydrogenase, mitochondrial (see paper)
37% identity, 97% coverage: 4:379/387 of query aligns to 11:386/393 of 8sgrA
- binding flavin-adenine dinucleotide: S135 (≠ T126), G140 (= G131), S141 (= S132), W165 (≠ F156), T167 (≠ S158), R279 (= R272), F282 (= F275), I286 (= I279), F289 (= F282), Q347 (= Q340), C348 (≠ I341), G351 (= G344), L369 (≠ V362), G375 (= G368), T376 (= T369), L382 (≠ H375)
P26440 Isovaleryl-CoA dehydrogenase, mitochondrial; IVD; Butyryl-CoA dehydrogenase; EC 1.3.8.4; EC 1.3.8.1 from Homo sapiens (Human) (see 5 papers)
37% identity, 97% coverage: 4:379/387 of query aligns to 44:419/426 of P26440
- 165:174 (vs. 123:132, 80% identical) binding
- S174 (= S132) binding
- WIT 198:200 (≠ FIS 156:158) binding
- SR 222:223 (≠ KK 182:183) binding
- G250 (= G210) to A: in IVA; uncertain significance
- Y277 (≠ D237) binding
- DLER 284:287 (≠ GATR 244:247) binding
- E286 (≠ T246) active site, Proton acceptor; mutation to D: Residual isovaleryl-CoA dehydrogenase activity.; mutation to G: Loss of isovaleryl-CoA dehydrogenase activity. Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 407-E.; mutation to Q: Loss of isovaleryl-CoA dehydrogenase activity.
- A291 (= A251) to V: in IVA; uncertain significance; dbSNP:rs886042098
- R312 (= R272) binding
- Q323 (= Q283) binding
- I379 (= I339) to T: in IVA; uncertain significance
- QCFGG 380:384 (≠ QIHGG 340:344) binding
- R398 (= R358) to Q: in IVA; uncertain significance; dbSNP:rs1477527791
- Y403 (≠ E363) to N: in IVA; uncertain significance
- A407 (≠ E367) mutation to E: Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 286-D.
- AG 407:408 (≠ EG 367:368) binding
- TSE 409:411 (= TSE 369:371) binding
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
3mdeA Crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate (see paper)
36% identity, 98% coverage: 1:380/387 of query aligns to 2:379/385 of 3mdeA
- active site: V125 (≠ M125), T126 (= T126), T245 (= T246), E366 (= E367), R378 (= R379)
- binding octanoyl-coenzyme a: T86 (≠ V92), E89 (≠ P95), L93 (vs. gap), S132 (= S132), V134 (≠ L134), S181 (≠ K183), F235 (= F236), M239 (≠ N240), F242 (≠ L243), R314 (≠ V315), Y365 (≠ W366), E366 (= E367), G367 (= G368)
- binding flavin-adenine dinucleotide: Y123 (≠ L123), V125 (≠ M125), T126 (= T126), G131 (= G131), S132 (= S132), W156 (≠ F156), I157 (= I157), T158 (≠ S158), R271 (= R272), T273 (≠ Q274), F274 (= F275), L278 (≠ I279), H281 (≠ F282), Q339 (= Q340), V340 (≠ I341), G343 (= G344), I361 (≠ V362), T368 (= T369), Q370 (≠ E371)
3mddA Crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate (see paper)
36% identity, 98% coverage: 1:380/387 of query aligns to 2:379/385 of 3mddA
- active site: V125 (≠ M125), T126 (= T126), T245 (= T246), E366 (= E367), R378 (= R379)
- binding flavin-adenine dinucleotide: Y123 (≠ L123), T126 (= T126), G131 (= G131), S132 (= S132), W156 (≠ F156), T158 (≠ S158), R271 (= R272), T273 (≠ Q274), F274 (= F275), H281 (≠ F282), Q339 (= Q340), V340 (≠ I341), G343 (= G344), I361 (≠ V362), T368 (= T369), Q370 (≠ E371)
Query Sequence
>GFF3369 FitnessBrowser__Phaeo:GFF3369
MQFGLSEEQSMIVDTTRAFVTKELYPHELEVERSGHLPMELVREIQAKAIEAGLYAANMP
EEVGGAGLDTLTWLLYEKELGRANYALHWTCVARPSNILLAGTEEQKEKYLYPCIRGEKW
DCLAMTEPGAGSDLRGMTATARQDGDEFILNGTKHFISHADIADFAIVFMATGEEDTPRG
PKKKITAFFVDKGTPGFTIRDGYRNVSHRGYTNAVLEFDDCRLPKSSVLGEVDKGFDVAN
TWLGATRLQVAATCLGRAERALDHAISYAAERRQFGQQIGKFQGVSFKLADMATELKAAN
LLTWEAAWKFDQGSVTEADMSMAKLKATEMLAMVADEAIQIHGGMGLMDELPLERIWRDA
RVERIWEGTSEIQRHIISRELLRAQGG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory