Comparing GFF3373 FitnessBrowser__Marino:GFF3373 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
50% identity, 97% coverage: 11:388/389 of query aligns to 2:378/380 of 7rsfA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
29% identity, 85% coverage: 53:384/389 of query aligns to 43:362/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
29% identity, 85% coverage: 53:384/389 of query aligns to 44:357/360 of 2f7vA
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
27% identity, 90% coverage: 7:355/389 of query aligns to 2:343/377 of P44514
Sites not aligning to the query:
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
27% identity, 90% coverage: 7:355/389 of query aligns to 6:347/380 of 5vo3A
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
28% identity, 83% coverage: 66:388/389 of query aligns to 53:382/383 of 7uoiA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
26% identity, 91% coverage: 35:387/389 of query aligns to 22:374/377 of 7t1qA
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
24% identity, 96% coverage: 16:387/389 of query aligns to 7:374/375 of 4pqaA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
24% identity, 96% coverage: 16:387/389 of query aligns to 7:374/376 of 4o23A
7lgpB Dape enzyme from shigella flexneri
26% identity, 88% coverage: 45:388/389 of query aligns to 31:376/377 of 7lgpB
5xoyA Crystal structure of lysk from thermus thermophilus in complex with lysine (see paper)
28% identity, 89% coverage: 41:388/389 of query aligns to 23:338/341 of 5xoyA
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
34% identity, 45% coverage: 7:180/389 of query aligns to 4:170/258 of 4h2kA
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
26% identity, 71% coverage: 52:327/389 of query aligns to 45:335/408 of Q03154
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
31% identity, 54% coverage: 66:274/389 of query aligns to 82:297/426 of 3pfoA
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
26% identity, 64% coverage: 42:289/389 of query aligns to 35:294/407 of P37111
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
25% identity, 84% coverage: 49:373/389 of query aligns to 74:397/415 of P06621
1cg2A Carboxypeptidase g2 (see paper)
25% identity, 84% coverage: 49:373/389 of query aligns to 49:372/389 of 1cg2A
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
28% identity, 65% coverage: 7:260/389 of query aligns to 16:279/458 of 2pokA
Sites not aligning to the query:
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
28% identity, 56% coverage: 18:235/389 of query aligns to 22:256/475 of Q96KP4
Sites not aligning to the query:
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
24% identity, 78% coverage: 69:373/389 of query aligns to 4:307/392 of 7m6uB
>GFF3373 FitnessBrowser__Marino:GFF3373
MSQSDSKSAVVPGIRDMLARLISLPSISSASAKWDHSNEPVVRTLAEWLEALGFSVEILE
VPGMPGKFNLIGTLGSGPGGLVLSGHTDTVPFDDKRWQSDPFTLTERDNRWYGLGTCDMK
GFFPLAIEAARAFVDEDLKQPLIILATADEESSMDGARALAEAGKPKARYAVIGEPTSLK
PVRMHKGIMMERLKFEGQSGHSSNPALGRNAMEGMHEALTELLALRSGWQEKYRNPNFEV
QFPTLNLGCIHGGDNPNRICAQCELHFDLRPLPGMNMETLRQAILSKVQPIADRRELSLE
FEPLFDGVPPFETPADAALVKACEKLTGHTAHAVAFATEAPWLQKLGLETLVMGPGSIDQ
AHQPDEFIELSQIDPTVKVLRGLIRQFCL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory