Comparing GFF3387 FitnessBrowser__Phaeo:GFF3387 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
60% identity, 95% coverage: 8:450/464 of query aligns to 1:444/450 of 6gwiB
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
59% identity, 96% coverage: 10:455/464 of query aligns to 2:442/443 of 7qx0B
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
59% identity, 91% coverage: 36:455/464 of query aligns to 1:421/422 of 7qx3A
5ti8B Crystal structure of an aspartate aminotransferase from pseudomonas (see paper)
62% identity, 90% coverage: 37:453/464 of query aligns to 1:381/384 of 5ti8B
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
54% identity, 96% coverage: 10:456/464 of query aligns to 2:449/453 of 6s4gA
7q9xAAA Probable aminotransferase
54% identity, 96% coverage: 10:456/464 of query aligns to 3:450/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
54% identity, 96% coverage: 10:456/464 of query aligns to 3:450/455 of 4a6tC
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
54% identity, 91% coverage: 36:456/464 of query aligns to 1:422/427 of 4ba5A
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
54% identity, 91% coverage: 37:456/464 of query aligns to 1:418/423 of 4a6rA
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
51% identity, 96% coverage: 11:456/464 of query aligns to 4:452/454 of 7ypmA
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
51% identity, 96% coverage: 11:456/464 of query aligns to 4:452/455 of 7ypnD
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
44% identity, 95% coverage: 10:449/464 of query aligns to 6:454/460 of 5kr6B
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
44% identity, 95% coverage: 12:451/464 of query aligns to 4:452/455 of 5kr5A
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
43% identity, 95% coverage: 12:450/464 of query aligns to 6:453/459 of 5kquC
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
44% identity, 95% coverage: 12:451/464 of query aligns to 7:453/458 of 5kr3A
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
42% identity, 94% coverage: 17:450/464 of query aligns to 7:444/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
42% identity, 94% coverage: 17:450/464 of query aligns to 7:444/451 of 6g4eA
5ghgB Transaminase w58l with smba
41% identity, 95% coverage: 13:455/464 of query aligns to 4:431/433 of 5ghgB
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
42% identity, 94% coverage: 17:450/464 of query aligns to 7:444/453 of 6g4dB
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
44% identity, 93% coverage: 11:441/464 of query aligns to 6:436/448 of 6io1B
>GFF3387 FitnessBrowser__Phaeo:GFF3387
MTAITNHLPTAELQALDAAHHMHPFTANGELAEKGARIITRARGVTLTDSEGNEILDAMA
GLWCVNIGYGRDELADVAARQMRELPYYNTFFQTTHAPAIALAAKIAELAPDGLNHVFFA
GSGSEANDTNIRMVRHYWAMKAKPTKSVIISRKNGYHGSSVGSGSLGGMTAMHEQGGLPI
PDIHHINQPNWWAEGGDMSAEDFGLARAQELEQAILELGEDRVAAFIAEPVQGAGGVIVP
PATYWPEIQRICDKYEILLIADEVICGFGRTGNWFGSQSVGIRPDIMTIAKGLSSGYAPI
GGSIVSDEIASVIGSGEFNHGYTYSGHPVAAAVALENLRILEEENIIGHVRDVAAPYLKE
KWEALADHPLVGEAKIVGMMGSIALTPNKATRAGFAAEGGTVGYICRERCFANNLVMRHV
GDRMIISPPLVITPEEIDTLIARARQSLDECYAALQDQDMLRSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory