Comparing GFF3388 FitnessBrowser__psRCH2:GFF3388 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
34% identity, 42% coverage: 198:417/518 of query aligns to 107:334/334 of P0DPQ8
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
34% identity, 42% coverage: 198:417/518 of query aligns to 106:333/333 of 5ogxA
Sites not aligning to the query:
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
31% identity, 43% coverage: 189:413/518 of query aligns to 5:235/237 of 4eh1A
6laaA Crystal structure of full-length cyp116b46 from tepidiphilus thermophilus (see paper)
27% identity, 55% coverage: 221:505/518 of query aligns to 472:739/753 of 6laaA
Sites not aligning to the query:
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
28% identity, 43% coverage: 192:413/518 of query aligns to 157:390/396 of 1gvhA
Sites not aligning to the query:
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
28% identity, 43% coverage: 192:413/518 of query aligns to 157:390/396 of P24232
Sites not aligning to the query:
7ylrA Structure of a bacteria protein
28% identity, 51% coverage: 254:517/518 of query aligns to 78:326/326 of 7ylrA
Sites not aligning to the query:
6vjvA Crystal structure of the prochlorococcus phage (myovirus p-ssm2) ferredoxin at 1.6 angstroms (see paper)
43% identity, 14% coverage: 438:511/518 of query aligns to 10:83/96 of 6vjvA
Sites not aligning to the query:
1ewyC Anabaena pcc7119 ferredoxin:ferredoxin-NADP+-reductase complex (see paper)
39% identity, 14% coverage: 438:511/518 of query aligns to 12:85/98 of 1ewyC
1czpA Anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a (see paper)
39% identity, 14% coverage: 438:511/518 of query aligns to 12:85/98 of 1czpA
P0A3C7 Ferredoxin-1; Ferredoxin I from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
39% identity, 14% coverage: 438:511/518 of query aligns to 13:86/99 of P0A3C7
Sites not aligning to the query:
1frrA Crystal structure of [2fe-2s] ferredoxin i from equisetum arvense at 1.8 angstroms resolution (see paper)
46% identity, 13% coverage: 444:511/518 of query aligns to 15:82/95 of 1frrA
7fixR1 Photosystem I reaction center subunit PsaK (see paper)
39% identity, 14% coverage: 438:511/518 of query aligns to 11:84/97 of 7fixR1
6khi1 Supercomplex for cylic electron transport in cyanobacteria (see paper)
39% identity, 14% coverage: 438:511/518 of query aligns to 12:85/98 of 6khi1
4zhoA The crystal structure of arabidopsis ferredoxin 2 with 2fe-2s cluster (see paper)
47% identity, 12% coverage: 452:511/518 of query aligns to 24:83/97 of 4zhoA
1rfkB Crystal structure of 2fe2s ferredoxin from thermophilic cyanobacterium mastigocladus laminosus (see paper)
36% identity, 14% coverage: 438:511/518 of query aligns to 12:85/97 of 1rfkB
7c3bC Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
29% identity, 47% coverage: 173:413/518 of query aligns to 101:333/334 of 7c3bC
Sites not aligning to the query:
2piaA Phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s] (see paper)
21% identity, 54% coverage: 238:517/518 of query aligns to 55:320/321 of 2piaA
Sites not aligning to the query:
7s3dX Structure of photosystem i with bound ferredoxin from synechococcus sp. Pcc 7335 acclimated to far-red light (see paper)
40% identity, 13% coverage: 444:511/518 of query aligns to 17:84/97 of 7s3dX
7c3aA Ferredoxin reductase in carbazole 1,9a-dioxygenase (see paper)
29% identity, 47% coverage: 173:413/518 of query aligns to 100:320/321 of 7c3aA
Sites not aligning to the query:
>GFF3388 FitnessBrowser__psRCH2:GFF3388
MAAFKRFRLFHWLLAGFFVAVYLSGDDAELLHVWLGYGLVALLVMRLLIAPLRLRGVPRL
LPAKMQRRNLSLTSFGTWLTFATLLSLALASLLGLGMVDNGDVLAALPGVGPDLFGSASD
IDFVGWLGDAEEVHEFFANLALTLVALHIGYVVLFRRTAAWAMLRGPRQPAEPGAPVSVA
ASEAPAFAALTVIARQAETADAASFSLQVPAELRERFAAQPGQFVTLRVPCSEPPLLRSY
SLSKPLGSDGVLRISVRRVPGGRASNWLLDNLQVGQRIDVLPPAGRLVPHDLDGDLLLLG
AGSGITPLRAILQAALEQGRGRVFLFYASRDAASLIFAEELADFAARYPERLQLRIWLDA
EQGIPSAPAIAAKIGDWPQGEAFVCGPQPFMDGASVALAELDVSSDAIHVERFNTAAPVA
PLSELRQPLHSRLQVALDGRRHALDVQQGEVLLDAMEQAGLQPPSACRAGVCAACRCRVV
EGSVSMRSNQVLSDQQVRQGWTLACQAVPTSTRLAVEY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory