SitesBLAST
Comparing GFF3392 FitnessBrowser__WCS417:GFF3392 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q7CRQ0 Uronate dehydrogenase; D-galacturonate dehydrogenase; D-glucuronate dehydrogenase; Hexuronate dehydrogenase; EC 1.1.1.203 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
51% identity, 93% coverage: 11:266/274 of query aligns to 1:256/265 of Q7CRQ0
- Y134 (= Y145) mutation to A: 0.1% of wild-type activity.
3rfvA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens complexed with nadh and product (see paper)
51% identity, 93% coverage: 11:266/274 of query aligns to 2:257/265 of 3rfvA
- binding D-galactaro-1,5-lactone: S74 (= S84), S110 (= S120), N111 (= N121), H112 (= H122), Y135 (= Y145), S164 (= S174), R173 (= R183), F257 (= F266)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G18), G12 (= G21), Q13 (≠ G22), L14 (= L23), D33 (= D42), L34 (≠ I43), D50 (= D60), L51 (= L61), L70 (≠ F80), G71 (= G81), G72 (= G82), S74 (= S84), A108 (= A118), S110 (= S120), Y135 (= Y145), K139 (= K149), I162 (= I172), S164 (= S174), C165 (≠ S175)
3rfxA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with NAD (see paper)
51% identity, 93% coverage: 11:266/274 of query aligns to 2:257/265 of 3rfxA
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
31% identity, 58% coverage: 14:171/274 of query aligns to 2:158/321 of 4id9A
- active site: S106 (= S120), Y132 (= Y145), K136 (= K149)
- binding nicotinamide-adenine-dinucleotide: G9 (= G21), R10 (≠ G22), V11 (≠ L23), D30 (= D42), L31 (≠ M46), R32 (≠ A47), S44 (≠ D60), L45 (= L61), L64 (≠ F80), A66 (≠ G82), V81 (≠ A95), S106 (= S120), Y132 (= Y145), K136 (= K149)
Sites not aligning to the query:
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
31% identity, 58% coverage: 14:171/274 of query aligns to 3:159/328 of 4id9B
- active site: S107 (= S120), Y133 (= Y145), K137 (= K149)
- binding nicotinamide-adenine-dinucleotide: G10 (= G21), R11 (≠ G22), V12 (≠ L23), D31 (= D42), L32 (≠ M46), S45 (≠ D60), L46 (= L61), L65 (≠ F80), A67 (≠ G82), V82 (≠ A95), Y133 (= Y145), K137 (= K149)
Sites not aligning to the query:
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
30% identity, 62% coverage: 13:181/274 of query aligns to 3:180/308 of 6wj9B
- active site: A119 (≠ S120), A120 (≠ N121), A121 (≠ H122), F144 (≠ Y145), K148 (= K149)
- binding nicotinamide-adenine-dinucleotide: G8 (= G18), G11 (= G21), F12 (≠ G22), I13 (≠ L23), D32 (= D42), D33 (vs. gap), S35 (vs. gap), T36 (vs. gap), G37 (vs. gap), D55 (= D60), A56 (≠ L61), L75 (≠ F80), A76 (≠ G81), A77 (≠ G82), S94 (≠ A95), A117 (= A118), A119 (≠ S120), F144 (≠ Y145), K148 (= K149), F171 (≠ I172), F172 (≠ G173), I174 (≠ S175)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (= V85), N173 (≠ S174)
Sites not aligning to the query:
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
30% identity, 62% coverage: 13:181/274 of query aligns to 2:179/307 of 6wjaA
- active site: A118 (≠ S120), A119 (≠ N121), A120 (≠ H122), F143 (≠ Y145), K147 (= K149)
- binding nicotinamide-adenine-dinucleotide: G7 (= G18), G10 (= G21), F11 (≠ G22), I12 (≠ L23), D31 (= D42), D32 (vs. gap), S34 (vs. gap), T35 (vs. gap), G36 (vs. gap), A55 (≠ L61), L74 (≠ F80), A75 (≠ G81), A76 (≠ G82), S93 (≠ A95), F143 (≠ Y145), K147 (= K149), F170 (≠ I172), F171 (≠ G173), I173 (≠ S175)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (= V85), A120 (≠ H122), N172 (≠ S174)
Sites not aligning to the query:
6jygD Crystal structure of l-threonine dehydrogenase from phytophthora infestans (see paper)
28% identity, 58% coverage: 12:171/274 of query aligns to 1:162/307 of 6jygD
- binding citrate anion: Q11 (≠ G22), L73 (≠ S84), S74 (≠ V85), Y136 (= Y145)
- binding nicotinamide-adenine-dinucleotide: G7 (= G18), T9 (≠ A20), G10 (= G21), Q11 (≠ G22), I12 (≠ L23), D33 (= D42), I34 (= I43), K35 (≠ A44), D47 (= D60), V48 (≠ L61), M69 (≠ F80), A70 (≠ G81), S71 (≠ G82), L73 (≠ S84), V87 (≠ A95), P109 (≠ A118), S110 (= S119), T111 (≠ S120), Y136 (= Y145), K140 (= K149)
Sites not aligning to the query:
7cgvA Full consensus l-threonine 3-dehydrogenase, fctdh-iiym (NAD+ bound form) (see paper)
28% identity, 58% coverage: 12:171/274 of query aligns to 1:165/310 of 7cgvA
- binding nicotinamide-adenine-dinucleotide: G7 (= G18), G10 (= G21), Q11 (≠ G22), I12 (≠ L23), D33 (= D42), I34 (= I43), R35 (≠ M46), L48 (≠ C59), D49 (= D60), V50 (≠ L61), A72 (≠ G81), A73 (≠ G82), L75 (vs. gap), P112 (≠ A118), S114 (= S120), Y139 (= Y145), K143 (= K149)
Sites not aligning to the query:
3a4vA Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
26% identity, 41% coverage: 59:171/274 of query aligns to 46:163/311 of 3a4vA
- active site: T112 (≠ S120), Y137 (= Y145), K141 (= K149)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ C59), D47 (= D60), V48 (≠ L61), L69 (≠ F80), A70 (≠ G81), G71 (= G82), L73 (≠ S84), P110 (≠ A118), S111 (= S119), T112 (≠ S120), Y137 (= Y145), K141 (= K149)
- binding pyruvic acid: S74 (≠ V85), Y137 (= Y145)
Sites not aligning to the query:
3a1nA Crystal structure of l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
26% identity, 41% coverage: 59:171/274 of query aligns to 46:163/315 of 3a1nA
- active site: T112 (≠ S120), Y137 (= Y145), K141 (= K149)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ C59), D47 (= D60), L69 (≠ F80), A70 (≠ G81), G71 (= G82), L73 (≠ S84), S111 (= S119), Y137 (= Y145), K141 (= K149)
Sites not aligning to the query:
3aw9A Structure of udp-galactose 4-epimerase mutant
28% identity, 58% coverage: 13:171/274 of query aligns to 2:157/304 of 3aw9A
- active site: A105 (= A118), S107 (= S120), S108 (≠ N121), T109 (≠ H122), Y131 (= Y145), K135 (= K149)
- binding galactose-uridine-5'-diphosphate: P69 (≠ S84), V71 (≠ E86), S107 (= S120), Y131 (= Y145)
- binding nicotinamide-adenine-dinucleotide: G7 (= G18), G10 (= G21), F11 (≠ G22), I12 (≠ L23), D31 (= D42), I32 (= I43), R46 (≠ Q57), D47 (= D60), L48 (= L61), F65 (= F80), A66 (≠ G81), A67 (≠ G82), E82 (≠ A95), A105 (= A118), S106 (= S119), Y131 (= Y145), K135 (= K149)
Sites not aligning to the query:
- active site: 166, 169
- binding galactose-uridine-5'-diphosphate: 160, 168, 170, 173, 188, 193, 195, 197, 234, 263, 266
- binding nicotinamide-adenine-dinucleotide: 158, 160, 161, 168
5u4qB 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
29% identity, 60% coverage: 13:176/274 of query aligns to 3:181/304 of 5u4qB
- binding nicotinamide-adenine-dinucleotide: G8 (= G18), G11 (= G21), F12 (≠ G22), I13 (≠ L23), D32 (≠ A44), N33 (= N45), N35 (≠ A47), Y38 (≠ A50), K43 (≠ E55), D61 (= D60), L62 (= L61), L83 (≠ F80), A84 (≠ G81), A85 (vs. gap), A123 (= A118), Y150 (= Y145), K154 (= K149), F177 (≠ I172), V180 (≠ S175)
Sites not aligning to the query:
5z75A Artificial l-threonine 3-dehydrogenase designed by ancestral sequence reconstruction. (see paper)
26% identity, 58% coverage: 13:171/274 of query aligns to 4:166/306 of 5z75A
- binding nicotinamide-adenine-dinucleotide: G9 (= G18), C11 (≠ A20), G12 (= G21), Q13 (≠ G22), I14 (≠ L23), D35 (= D42), I36 (= I43), L49 (≠ C59), V51 (≠ L61), L72 (≠ F80), A73 (≠ G81), L76 (≠ S84), P113 (≠ A118), S115 (= S120), Y140 (= Y145), K144 (= K149)
Sites not aligning to the query:
3ajrA Crystal structure of l-3-hydroxynorvaline bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
25% identity, 41% coverage: 59:171/274 of query aligns to 46:163/314 of 3ajrA
- binding nicotinamide-adenine-dinucleotide: L46 (≠ C59), D47 (= D60), V48 (≠ L61), L69 (≠ F80), A70 (≠ G81), G71 (= G82), L73 (≠ S84), P110 (≠ A118), S111 (= S119), T112 (≠ S120), F137 (≠ Y145), K141 (= K149)
- binding (3R)-3-hydroxy-L-norvaline: S74 (≠ V85), T112 (≠ S120), I113 (≠ N121), F137 (≠ Y145)
Sites not aligning to the query:
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
31% identity, 60% coverage: 13:176/274 of query aligns to 2:182/322 of 1r6dA
- active site: T127 (≠ S120), N128 (= N121), Q129 (≠ H122), Y151 (= Y145), K155 (= K149)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (= S84), H88 (vs. gap), T127 (≠ S120), N128 (= N121), Q129 (≠ H122), Y151 (= Y145), N180 (≠ S174)
- binding nicotinamide-adenine-dinucleotide: G10 (= G21), F11 (≠ G22), I12 (≠ L23), D37 (≠ S41), S38 (≠ D42), L39 (≠ I43), T40 (vs. gap), A42 (vs. gap), G43 (vs. gap), D63 (= D60), I64 (≠ L61), F83 (= F80), A84 (≠ G81), A85 (≠ G82), S87 (= S84), T102 (≠ V92), V125 (≠ A118), S126 (= S119), Y151 (= Y145), K155 (= K149), N181 (≠ S175)
Sites not aligning to the query:
3a9wA Crystal structure of l-threonine bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
25% identity, 41% coverage: 59:171/274 of query aligns to 46:163/315 of 3a9wA
- binding nicotinamide-adenine-dinucleotide: L46 (≠ C59), D47 (= D60), V48 (≠ L61), L69 (≠ F80), A70 (≠ G81), L73 (≠ S84), V87 (≠ A95), P110 (≠ A118), S111 (= S119), K141 (= K149)
- binding threonine: S74 (≠ V85), T112 (≠ S120), F137 (≠ Y145)
Sites not aligning to the query:
5u4qA 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
28% identity, 60% coverage: 13:176/274 of query aligns to 3:176/321 of 5u4qA
- binding nicotinamide-adenine-dinucleotide: G8 (= G18), G11 (= G21), F12 (≠ G22), I13 (≠ L23), D32 (≠ A44), N33 (= N45), N35 (≠ A47), Y38 (≠ A50), K43 (≠ E55), D61 (= D60), L62 (= L61), L83 (≠ F80), A84 (≠ G81), A85 (≠ G82), A118 (= A118), Y145 (= Y145), K149 (= K149), F172 (≠ I172), F173 (≠ G173), T174 (≠ S174), V175 (≠ S175)
Sites not aligning to the query:
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
30% identity, 60% coverage: 13:176/274 of query aligns to 2:182/322 of 1r66A
- active site: T127 (≠ S120), D128 (≠ N121), E129 (≠ H122), Y151 (= Y145), K155 (= K149)
- binding nicotinamide-adenine-dinucleotide: G10 (= G21), F11 (≠ G22), I12 (≠ L23), D37 (≠ S41), S38 (≠ D42), L39 (≠ I43), T40 (vs. gap), G43 (vs. gap), D63 (= D60), I64 (≠ L61), F83 (= F80), A84 (≠ G81), A85 (≠ G82), S87 (= S84), T102 (≠ V92), V125 (≠ A118), S126 (= S119), Y151 (= Y145), K155 (= K149), N181 (≠ S175)
- binding thymidine-5'-diphosphate: H88 (vs. gap), E129 (≠ H122), N180 (≠ S174)
Sites not aligning to the query:
Q93VR3 GDP-mannose 3,5-epimerase; GDP-Man 3,5-epimerase; EC 5.1.3.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 59% coverage: 13:173/274 of query aligns to 29:199/377 of Q93VR3
- 34:60 (vs. 18:44, 26% identical) binding
- D58 (= D42) binding
- D78 (= D60) binding
- C145 (≠ H122) mutation to A: Loss of activity.; mutation to S: Strong reduction of activity.
- Y174 (= Y145) binding ; mutation to F: Loss of activity.
- K178 (= K149) binding ; mutation to R: Strong reduction of activity.
Sites not aligning to the query:
- 217 K→A: Loss of activity.
- 306 R→A: Strong reduction of activity.
Query Sequence
>GFF3392 FitnessBrowser__WCS417:GFF3392
MTTTPTTPVPFNRLLLTGAAGGLGKVLRERLRPYAQVLRLSDIANMAPAADASEEVQPCD
LADKQAVHHLVEGVDAILHFGGVSVERSFEEVLGANISGIFHIYEAARRHGVKRVIFASS
NHVIGFYKQGEKLDAHSPRRPDSYYGLSKSYGEDMASFYFDRYGIETVSIRIGSSFPEPQ
NRRMMHTWLSFDDLTQLLERALYTPNVGHTVVYGMSDNLDTWWDNRYAAHLGFAPKDSSE
VFRAQVETQPPVSDNDPAKVYQGGAFCAAGPFGD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory