SitesBLAST
Comparing GFF3394 FitnessBrowser__Phaeo:GFF3394 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2c20A Crystal structure of udp-glucose 4-epimerase
50% identity, 99% coverage: 4:327/327 of query aligns to 3:329/329 of 2c20A
- active site: T117 (= T117), A118 (≠ C118), A119 (= A119), Y141 (= Y141), K145 (= K145), H184 (= H184)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (= Y12), I12 (= I13), D31 (= D32), N32 (= N33), Q34 (≠ V35), T35 (= T36), G36 (= G37), D51 (= D51), L52 (= L52), F73 (= F73), A74 (= A74), A75 (= A75), N92 (= N92), Y141 (= Y141), K145 (= K145), Y168 (= Y168), F169 (= F169), V171 (= V171), H184 (= H184)
- binding zinc ion: E182 (= E182), H184 (= H184), E187 (= E187), H189 (= H189)
4twrA Structure of udp-glucose 4-epimerase from brucella abortus
48% identity, 96% coverage: 2:316/327 of query aligns to 2:316/325 of 4twrA
- active site: S117 (≠ T117), C118 (= C118), A119 (= A119), Y141 (= Y141), K145 (= K145), H184 (= H184), H189 (= H189)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (≠ Y12), I13 (= I13), D32 (= D32), N33 (= N33), L34 (= L34), S35 (≠ V35), T36 (= T36), G37 (= G37), D51 (= D51), I52 (≠ L52), F73 (= F73), A74 (= A74), A75 (= A75), N92 (= N92), S115 (= S115), K145 (= K145), Y168 (= Y168), A171 (≠ V171), H184 (= H184)
- binding zinc ion: E182 (= E182), H184 (= H184), E187 (= E187), H189 (= H189)
Q9SA77 UDP-arabinose 4-epimerase 1; UDP-D-xylose 4-epimerase 1; EC 5.1.3.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
41% identity, 98% coverage: 1:321/327 of query aligns to 70:403/419 of Q9SA77
- G275 (≠ P192) mutation to D: In mur4-1; 50% reduction in L-Ara in cell wall material.
- R304 (= R221) mutation to Q: In mur4-3; 50% reduction in L-Ara in cell wall material.
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
40% identity, 98% coverage: 2:321/327 of query aligns to 2:327/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), Y12 (= Y12), I13 (= I13), D32 (= D32), N33 (= N33), S35 (≠ V35), G37 (= G37), D57 (= D51), L58 (= L52), F79 (= F73), A80 (= A74), I83 (≠ S77), N98 (= N92), Y147 (= Y141), K151 (= K145), Y175 (= Y168), N177 (= N170), V178 (= V171)
2cnbA Trypanosoma brucei udp-galactose-4-epimerase in ternary complex with NAD and the substrate analogue udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
38% identity, 97% coverage: 4:321/327 of query aligns to 5:359/366 of 2cnbA
- active site: S144 (≠ T117), A145 (≠ C118), A146 (= A119), Y169 (= Y141), K173 (= K145)
- binding nicotinamide-adenine-dinucleotide: G9 (= G8), G12 (= G11), Y13 (= Y12), I14 (= I13), D34 (= D32), S35 (≠ N33), V37 (= V35), G38 (vs. gap), D77 (= D51), V78 (≠ L52), M100 (≠ F73), C101 (≠ A74), A102 (= A75), L104 (≠ S77), N119 (= N92), S143 (= S116), S144 (≠ T117), Y169 (= Y141), K173 (= K145), Y196 (= Y168), F197 (= F169), A199 (≠ V171)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: L104 (≠ S77), S144 (≠ T117), Y169 (= Y141), F197 (= F169), N198 (= N170), H217 (= H189), L218 (= L190), P238 (≠ T206), I239 (= I207), F240 (= F208), C251 (= C219), R253 (= R221), V297 (= V259), R320 (= R282), D323 (= D285)
1gy8C Trypanosoma brucei udp-galactose 4' epimerase (see paper)
38% identity, 97% coverage: 4:321/327 of query aligns to 5:363/370 of 1gy8C
- active site: S144 (≠ T117), A145 (≠ C118), A146 (= A119), Y170 (= Y141), K174 (= K145)
- binding nicotinamide-adenine-dinucleotide: G9 (= G8), G12 (= G11), Y13 (= Y12), I14 (= I13), D34 (= D32), S35 (≠ N33), L36 (= L34), V37 (= V35), G38 (vs. gap), D77 (= D51), V78 (≠ L52), M100 (≠ F73), C101 (≠ A74), A102 (= A75), L104 (≠ S77), N119 (= N92), S142 (= S115), S143 (= S116), S144 (≠ T117), Y170 (= Y141), K174 (= K145), Y197 (= Y168), A200 (≠ V171)
- binding uridine-5'-diphosphate: N199 (= N170), H218 (= H189), L219 (= L190), I222 (≠ L193), M241 (≠ L205), P242 (≠ T206), I243 (= I207), F244 (= F208), C255 (= C219), R257 (= R221), R324 (= R282), D327 (= D285)
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
38% identity, 97% coverage: 4:320/327 of query aligns to 3:329/338 of 1udaA
- active site: S124 (≠ T117), A125 (≠ C118), T126 (≠ A119), Y149 (= Y141), K153 (= K145), M189 (≠ V180)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (= Y12), I12 (= I13), D31 (= D32), N32 (= N33), L33 (= L34), C34 (≠ V35), N35 (≠ T36), S36 (≠ G37), D58 (= D51), I59 (≠ L52), F80 (= F73), A81 (= A74), G82 (≠ A75), K84 (≠ S77), S122 (= S115), Y149 (= Y141), K153 (= K145), Y177 (= Y168), P180 (≠ V171)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (≠ A119), N179 (= N170), N199 (≠ H189), L200 (= L190), A216 (≠ T206), I217 (= I207), F218 (= F208), R231 (= R221), Y233 (= Y223), R292 (= R282), D295 (= D285), Y299 (≠ L289)
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
38% identity, 97% coverage: 4:320/327 of query aligns to 3:329/338 of 1naiA
- active site: S124 (≠ T117), A125 (≠ C118), T126 (≠ A119), Y149 (= Y141), K153 (= K145), M189 (≠ V180)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (= Y12), I12 (= I13), D31 (= D32), N32 (= N33), L33 (= L34), C34 (≠ V35), N35 (≠ T36), S36 (≠ G37), D58 (= D51), I59 (≠ L52), F80 (= F73), A81 (= A74), G82 (≠ A75), K84 (≠ S77), Y149 (= Y141), K153 (= K145), Y177 (= Y168), P180 (≠ V171)
- binding 1,3-propandiol: N35 (≠ T36), K84 (≠ S77), E191 (= E182), P193 (= P186)
- binding uridine-5'-diphosphate: N179 (= N170), N199 (≠ H189), L200 (= L190), L215 (= L205), A216 (≠ T206), R231 (= R221), Y233 (= Y223), R292 (= R282)
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
38% identity, 97% coverage: 4:320/327 of query aligns to 3:329/338 of 1lrjA
- active site: S124 (≠ T117), A125 (≠ C118), T126 (≠ A119), Y149 (= Y141), K153 (= K145), M189 (≠ V180)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (= Y12), I12 (= I13), D31 (= D32), N32 (= N33), L33 (= L34), C34 (≠ V35), N35 (≠ T36), S36 (≠ G37), D58 (= D51), I59 (≠ L52), F80 (= F73), A81 (= A74), G82 (≠ A75), K84 (≠ S77), Y149 (= Y141), K153 (= K145), Y177 (= Y168), P180 (≠ V171)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (= V79), S124 (≠ T117), F178 (= F169), N179 (= N170), L200 (= L190), L215 (= L205), A216 (≠ T206), F218 (= F208), R231 (= R221), Y233 (= Y223), V269 (= V259), R292 (= R282), D295 (= D285)
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
38% identity, 97% coverage: 4:320/327 of query aligns to 3:329/338 of 2udpA
- active site: S124 (≠ T117), A125 (≠ C118), T126 (≠ A119), Y149 (= Y141), K153 (= K145), M189 (≠ V180)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (= Y12), I12 (= I13), D31 (= D32), N32 (= N33), L33 (= L34), C34 (≠ V35), N35 (≠ T36), S36 (≠ G37), D58 (= D51), I59 (≠ L52), F80 (= F73), A81 (= A74), G82 (≠ A75), K84 (≠ S77), S122 (= S115), S124 (≠ T117), Y149 (= Y141), K153 (= K145), Y177 (= Y168)
- binding phenyl-uridine-5'-diphosphate: N179 (= N170), N199 (≠ H189), L200 (= L190), A216 (≠ T206), I217 (= I207), F218 (= F208), R231 (= R221), Y233 (= Y223), V269 (= V259), R292 (= R282), D295 (= D285)
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
38% identity, 97% coverage: 4:320/327 of query aligns to 3:329/338 of 1udcA
- active site: S124 (≠ T117), A125 (≠ C118), T126 (≠ A119), Y149 (= Y141), K153 (= K145), M189 (≠ V180)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (= Y12), I12 (= I13), D31 (= D32), N32 (= N33), C34 (≠ V35), N35 (≠ T36), S36 (≠ G37), D58 (= D51), I59 (≠ L52), F80 (= F73), A81 (= A74), G82 (≠ A75), K84 (≠ S77), S122 (= S115), Y149 (= Y141), K153 (= K145), Y177 (= Y168), P180 (≠ V171)
- binding uridine-5'-diphosphate-mannose: T126 (≠ A119), Y149 (= Y141), N179 (= N170), N199 (≠ H189), L200 (= L190), L215 (= L205), A216 (≠ T206), I217 (= I207), F218 (= F208), R231 (= R221), Y233 (= Y223), V269 (= V259), R292 (= R282)
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
38% identity, 97% coverage: 4:320/327 of query aligns to 3:329/338 of P09147
- YI 11:12 (= YI 12:13) binding
- DNLCNS 31:36 (≠ DNLVTG 32:37) binding
- DI 58:59 (≠ DL 51:52) binding
- FAGLK 80:84 (≠ FAALS 73:77) binding
- N99 (= N92) binding
- S124 (≠ T117) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y141) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K145) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
- F178 (= F169) binding
- Y299 (≠ L289) mutation to C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1kvrA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
38% identity, 97% coverage: 4:320/327 of query aligns to 3:329/338 of 1kvrA
- active site: A124 (≠ T117), A125 (≠ C118), T126 (≠ A119), Y149 (= Y141), K153 (= K145), M189 (≠ V180)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (= Y12), I12 (= I13), D31 (= D32), N32 (= N33), C34 (≠ V35), N35 (≠ T36), S36 (≠ G37), D58 (= D51), I59 (≠ L52), F80 (= F73), A81 (= A74), G82 (≠ A75), K84 (≠ S77), S122 (= S115), S123 (= S116), Y149 (= Y141), K153 (= K145), Y177 (= Y168), P180 (≠ V171)
- binding uridine-5'-diphosphate: N179 (= N170), N198 (≠ T188), N199 (≠ H189), L200 (= L190), A216 (≠ T206), I217 (= I207), F218 (= F208), R231 (= R221), Y233 (= Y223), V269 (= V259), R292 (= R282), D295 (= D285)
Q14376 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Homo sapiens (Human) (see 13 papers)
38% identity, 97% coverage: 4:321/327 of query aligns to 5:338/348 of Q14376
- GYI 12:14 (= GYI 11:13) binding
- DNFHN 33:37 (≠ DNLVT 32:36) binding
- N34 (= N33) to S: in GALAC3; peripheral; nearly normal activity towards UDP-galactose; dbSNP:rs121908046
- DI 66:67 (≠ DL 51:52) binding
- F88 (= F73) binding
- G90 (≠ A75) to E: in GALAC3; 800-fold decrease in UDP-galactose epimerization activity; dbSNP:rs28940882
- K92 (≠ S77) binding
- V94 (= V79) to M: in GALAC3; generalized; 30-fold decrease in UDP-galactose epimerization activity; 2-fold decrease in affinity for UDP-galactose; 24% of normal activity with respect to UDP-N-acetylgalactosamine; dbSNP:rs121908047
- D103 (≠ R88) to G: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs28940883
- S132 (≠ T117) mutation to A: Loss of activity.
- SAT 132:134 (≠ TCA 117:119) binding
- Y157 (= Y141) active site, Proton acceptor; mutation to F: Loss of activity.
- K161 (= K145) binding
- A180 (≠ S163) to V: in dbSNP:rs3204468
- L183 (≠ F166) to P: in GALAC3; peripheral; 3-fold decrease in UDP-galactose epimerization activity; dbSNP:rs121908045
- Y185 (= Y168) binding
- YFN 185:187 (= YFN 168:170) binding
- NNL 206:208 (≠ THL 188:190) binding
- NVF 224:226 (≠ TIF 206:208) binding
- R239 (= R221) binding
- K257 (≠ W239) to R: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; does not affect affinity for UDP-galactose; dbSNP:rs28940884
- REGD 300:303 (≠ RAGD 282:285) binding
- C307 (≠ L289) mutation to Y: No effect on activity towards UDP-galactose. Loss of activity towards UDP-N-acetylgalactosamine.
- L313 (≠ R295) to M: in GALAC3; 6-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs3180383
- G319 (= G301) to E: in GALAC3; nearly normal activity towards UDP-galactose; mild impairment under conditions of substrate limitation; dbSNP:rs28940885
- R335 (≠ G318) to H: in GALAC3; 2-fold decrease in UDP-galactose epimerization activity; dbSNP:rs368637540
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
38% identity, 97% coverage: 4:321/327 of query aligns to 5:338/346 of 1ek6A
- active site: S132 (≠ T117), A133 (≠ C118), T134 (≠ A119), Y157 (= Y141), K161 (= K145)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G8), G12 (= G11), Y13 (= Y12), I14 (= I13), D33 (= D32), N34 (= N33), H36 (≠ V35), N37 (≠ T36), D66 (= D51), I67 (≠ L52), F88 (= F73), A89 (= A74), G90 (≠ A75), K92 (≠ S77), S130 (= S115), S131 (= S116), S132 (≠ T117), Y157 (= Y141), K161 (= K145), Y185 (= Y168), P188 (≠ V171)
- binding uridine-5'-diphosphate-glucose: S132 (≠ T117), Y157 (= Y141), F186 (= F169), N187 (= N170), N207 (≠ H189), L208 (= L190), N224 (≠ T206), V225 (≠ I207), F226 (= F208), R239 (= R221), Y241 (= Y223), V277 (= V259), R300 (= R282), D303 (= D285)
1a9yA Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp- glucose (see paper)
38% identity, 97% coverage: 4:320/327 of query aligns to 3:329/338 of 1a9yA
- active site: A124 (≠ T117), A125 (≠ C118), T126 (≠ A119), F149 (≠ Y141), K153 (= K145)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (= Y12), I12 (= I13), D31 (= D32), N32 (= N33), C34 (≠ V35), N35 (≠ T36), S36 (≠ G37), D58 (= D51), I59 (≠ L52), F80 (= F73), A81 (= A74), G82 (≠ A75), K84 (≠ S77), S122 (= S115), S123 (= S116), F149 (≠ Y141), K153 (= K145), Y177 (= Y168), P180 (≠ V171)
- binding uridine-5'-diphosphate-glucose: A125 (≠ C118), T126 (≠ A119), N179 (= N170), N199 (≠ H189), L200 (= L190), A216 (≠ T206), I217 (= I207), F218 (= F208), R231 (= R221), Y233 (= Y223), R292 (= R282), D295 (= D285), Y299 (≠ L289)
1hzjA Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site (see paper)
38% identity, 97% coverage: 4:321/327 of query aligns to 4:337/345 of 1hzjA
- active site: S131 (≠ T117), A132 (≠ C118), T133 (≠ A119), Y156 (= Y141), K160 (= K145)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), Y12 (= Y12), I13 (= I13), D32 (= D32), N33 (= N33), H35 (≠ V35), N36 (≠ T36), D65 (= D51), I66 (≠ L52), F87 (= F73), A88 (= A74), G89 (≠ A75), K91 (≠ S77), S129 (= S115), S131 (≠ T117), Y156 (= Y141), K160 (= K145), Y184 (= Y168), P187 (≠ V171)
- binding uridine-diphosphate-n-acetylglucosamine: N186 (= N170), N206 (≠ H189), L207 (= L190), N223 (≠ T206), V224 (≠ I207), F225 (= F208), R238 (= R221), Y240 (= Y223), V276 (= V259), R299 (= R282), D302 (= D285)
1i3lA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
38% identity, 97% coverage: 4:321/327 of query aligns to 4:337/347 of 1i3lA
- active site: S131 (≠ T117), A132 (≠ C118), T133 (≠ A119), Y156 (= Y141), K160 (= K145)
- binding galactose-uridine-5'-diphosphate: N186 (= N170), N206 (≠ H189), L207 (= L190), N223 (≠ T206), V224 (≠ I207), F225 (= F208), R238 (= R221), Y240 (= Y223), V276 (= V259), R299 (= R282), D302 (= D285)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), Y12 (= Y12), I13 (= I13), D32 (= D32), N33 (= N33), H35 (≠ V35), N36 (≠ T36), D65 (= D51), I66 (≠ L52), F87 (= F73), A88 (= A74), G89 (≠ A75), K91 (≠ S77), S129 (= S115), S130 (= S116), S131 (≠ T117), Y156 (= Y141), K160 (= K145), Y184 (= Y168), P187 (≠ V171)
1i3kA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
38% identity, 97% coverage: 4:321/327 of query aligns to 4:337/347 of 1i3kA
- active site: S131 (≠ T117), A132 (≠ C118), T133 (≠ A119), Y156 (= Y141), K160 (= K145)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), Y12 (= Y12), I13 (= I13), D32 (= D32), N33 (= N33), H35 (≠ V35), N36 (≠ T36), D65 (= D51), I66 (≠ L52), F87 (= F73), A88 (= A74), G89 (≠ A75), K91 (≠ S77), S129 (= S115), S131 (≠ T117), Y156 (= Y141), K160 (= K145), Y184 (= Y168), P187 (≠ V171)
- binding uridine-5'-diphosphate-glucose: F185 (= F169), N186 (= N170), N206 (≠ H189), L207 (= L190), N223 (≠ T206), V224 (≠ I207), F225 (= F208), R238 (= R221), Y240 (= Y223), V276 (= V259), R299 (= R282), D302 (= D285)
7kn1A Crystal structure of udp-glucose-4-epimerase (gale) from stenotrophomonas maltophila with bound NAD and formylated udp- arabinopyranose
39% identity, 98% coverage: 3:322/327 of query aligns to 4:332/336 of 7kn1A
- active site: S126 (≠ T117), Y150 (= Y141), K154 (= K145)
- binding nicotinamide-adenine-dinucleotide: G9 (= G8), G12 (= G11), Y13 (= Y12), I14 (= I13), D33 (= D32), S34 (≠ N33), C36 (≠ V35), N37 (≠ T36), D60 (= D51), I61 (≠ L52), F82 (= F73), A83 (= A74), A84 (= A75), K86 (≠ S77), S124 (= S115), S125 (= S116), S126 (≠ T117), Y150 (= Y141), K154 (= K145), Y178 (= Y168), P181 (≠ V171)
- binding UDP-4-deoxy-4-formamido-beta-L-arabinopyranose: V88 (= V79), S126 (≠ T117), Y150 (= Y141), N180 (= N170), S199 (≠ T188), N200 (≠ H189), L201 (= L190), Q217 (≠ T206), V218 (≠ I207), F219 (= F208), R232 (= R221), Y234 (= Y223), V270 (= V259), R293 (= R282), D296 (= D285)
Query Sequence
>GFF3394 FitnessBrowser__Phaeo:GFF3394
MTHILVTGGAGYIGSHACKALRAAGFTPVTYDNLVTGWQDAVKFGPFEKGDLSDRARLDE
VFAKYQPAAVMHFAALSQVGEAMSEPGRYWANNVGGSLTLIEAAVAADCLDFVFSSTCAT
YGEHDNVVLDESTPQVPLNAYGASKRAVEDILRDFGASHGLRSVIFRYFNVAGADPEAEV
GEFHRPETHLVPLVLDAIDGKRDALTIFGTDYDTPDGTCVRDYVHVCDLVDAHVLGLKWL
KDGKGSQVFNLGTGTGFSVREVMDKAEATTGKSVPHSIGPRRAGDCTKLVSGSVRAATLL
GWEPTRSDLETMIADAWGWHKAGAYER
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory