Comparing GFF3394 FitnessBrowser__WCS417:GFF3394 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
83% identity, 93% coverage: 22:320/320 of query aligns to 1:299/306 of 4xfeA
4x04A Crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899, target efi-510094) with bound d- glucuronate
53% identity, 93% coverage: 24:320/320 of query aligns to 4:301/301 of 4x04A
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
43% identity, 93% coverage: 24:320/320 of query aligns to 6:304/304 of 4x8rA
4ovrA Crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d- galacturonate (see paper)
45% identity, 93% coverage: 23:318/320 of query aligns to 2:297/298 of 4ovrA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
46% identity, 92% coverage: 23:316/320 of query aligns to 2:297/300 of 4n8yA
Q128M1 Solute-binding protein Bpro_3107 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
43% identity, 94% coverage: 20:320/320 of query aligns to 29:327/330 of Q128M1
4mhfA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-glucuronate, space group p21 (see paper)
43% identity, 93% coverage: 23:320/320 of query aligns to 2:297/301 of 4mhfA
4mijA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21 (see paper)
43% identity, 93% coverage: 23:320/320 of query aligns to 2:297/302 of 4mijA
4pf8A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1 (target efi-510299) with bound beta-d- galacturonate (see paper)
41% identity, 91% coverage: 28:317/320 of query aligns to 6:295/300 of 4pf8A
4p3lA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound glucuronate, spg p6122 (see paper)
38% identity, 84% coverage: 28:297/320 of query aligns to 7:275/303 of 4p3lA
4ovqA Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans, target efi-510230, with bound beta-d- glucuronate (see paper)
40% identity, 92% coverage: 28:320/320 of query aligns to 7:299/302 of 4ovqA
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
36% identity, 94% coverage: 5:305/320 of query aligns to 9:311/328 of Q0B2F6
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
36% identity, 88% coverage: 24:305/320 of query aligns to 3:285/301 of 4n17A
4n15A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-glucuronate (see paper)
36% identity, 88% coverage: 24:305/320 of query aligns to 3:285/301 of 4n15A
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
33% identity, 82% coverage: 58:320/320 of query aligns to 38:298/303 of 4pddA
Sites not aligning to the query:
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
35% identity, 92% coverage: 12:305/320 of query aligns to 7:284/301 of 4nq8B
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
36% identity, 84% coverage: 38:305/320 of query aligns to 18:285/301 of 4pdhA
Sites not aligning to the query:
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
35% identity, 84% coverage: 38:305/320 of query aligns to 20:287/303 of 4p9kA
Sites not aligning to the query:
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
35% identity, 84% coverage: 38:305/320 of query aligns to 21:288/304 of 4pakA
Sites not aligning to the query:
4n91A Crystal structure of a trap periplasmic solute binding protein from anaerococcus prevotii dsm 20548 (apre_1383), target efi-510023, with bound alpha/beta d-glucuronate (see paper)
35% identity, 81% coverage: 60:317/320 of query aligns to 40:303/308 of 4n91A
Sites not aligning to the query:
>GFF3394 FitnessBrowser__WCS417:GFF3394
MDFKRTLLAAACFALSSAAHALEIKFADIHPAGYPTVVAEENMGKALTQASNGELTFKYF
PGGVLGSEKEVVEQAQVGAIQMTRVSLGIVGPVVPDVNVFNLPFVFRDQAHMRKVIDGEI
GDEILAKITDSEFGLVALAWMDGGTRNLYTKKPVRKIEDLKGMKIRVQGNPLFIEAFNEM
GANGIAMDTGEIFSALQTGVIDGAENNPPTLLEHNHFQNAKYYTLTEHLILPEPIVMSKI
TWNKLTPAQQDMVKKAAKAAQADERVLWDAKSASSETKLKAAGVEFITVDKKPFYDATAP
VRAKYGAAYADIIQRIDAVQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory