Comparing GFF3395 FitnessBrowser__Phaeo:GFF3395 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
56% identity, 93% coverage: 3:278/297 of query aligns to 3:275/288 of 2ux8G
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
50% identity, 95% coverage: 4:286/297 of query aligns to 4:285/290 of 5i1fA
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
49% identity, 95% coverage: 4:286/297 of query aligns to 2:279/282 of 5ve7A
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
49% identity, 93% coverage: 3:278/297 of query aligns to 3:242/255 of 2ux8A
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
49% identity, 90% coverage: 2:268/297 of query aligns to 5:271/281 of 8f73E
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
43% identity, 92% coverage: 5:278/297 of query aligns to 2:278/290 of 6knlA
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
43% identity, 92% coverage: 5:278/297 of query aligns to 2:278/290 of 6k8dA
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
44% identity, 91% coverage: 5:275/297 of query aligns to 2:264/265 of 3jukA
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
44% identity, 91% coverage: 5:275/297 of query aligns to 2:264/264 of 3jukD
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
45% identity, 95% coverage: 6:287/297 of query aligns to 3:285/291 of 8b6dA
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
42% identity, 92% coverage: 5:278/297 of query aligns to 2:273/285 of 6ikzB
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
43% identity, 95% coverage: 6:287/297 of query aligns to 3:280/286 of 8b68A
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
38% identity, 99% coverage: 5:297/297 of query aligns to 3:297/299 of 2pa4B
6n0uA Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
26% identity, 90% coverage: 7:272/297 of query aligns to 5:241/295 of 6n0uA
P26393 Glucose-1-phosphate thymidylyltransferase; dTDP-glucose pyrophosphorylase; Ep; dTDP-glucose synthase; EC 2.7.7.24 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
26% identity, 78% coverage: 4:234/297 of query aligns to 2:202/292 of P26393
Sites not aligning to the query:
P74285 UTP--glucose-1-phosphate uridylyltransferase; Cyanobacterial UDP-glucose pyrophosphorylase; UDP-glucose pyrophosphorylase; UDP-Glc PPase; EC 2.7.7.9 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
24% identity, 97% coverage: 7:294/297 of query aligns to 2:276/388 of P74285
1h5tA Thymidylyltransferase complexed with thymidylyldiphosphate-glucose (see paper)
26% identity, 78% coverage: 4:234/297 of query aligns to 1:201/290 of 1h5tA
Sites not aligning to the query:
1h5rA Thymidylyltransferase complexed with thimidine and glucose-1-phospate (see paper)
26% identity, 78% coverage: 4:234/297 of query aligns to 1:201/290 of 1h5rA
Sites not aligning to the query:
1h5sB Thymidylyltransferase complexed with tmp (see paper)
26% identity, 78% coverage: 4:234/297 of query aligns to 2:202/291 of 1h5sB
Sites not aligning to the query:
5ifyA Crystal structure of glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis in complex with 2 -deoxyuridine-5'- monophosphate and 2'-deoxy-thymidine-b-l-rhamnose
26% identity, 90% coverage: 7:272/297 of query aligns to 3:239/293 of 5ifyA
Sites not aligning to the query:
>GFF3395 FitnessBrowser__Phaeo:GFF3395
MRRKVTKAIFPVAGLGTRFLPATKSVPKEIMTLVDRPLVQYAIDEAREAGIKEFIFVTSR
GKGALEDYFDHSPMLEQELRKKGKDDLLDILKATNMDSGAIAYIRQHQALGLGHAVWCAR
RLIANEPFAVILPDDVIAAETPCLKQMVEAYEETGGNMVAAMEVPPEQTSSYGVLDVRDD
MGSVVSVNGMVEKPKAEEAPSNLAVIGRYILAPSVLRNLNKKKQGAGGEIQLTDAIAEDI
AADVPVYGYRFRGQRFDCGSKAGFLQATVAFALAREELRDDLMCYINQIAQVDKAAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory