Comparing GFF3397 FitnessBrowser__Phaeo:GFF3397 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 78% coverage: 25:232/265 of query aligns to 30:236/271 of Q9M8S8
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
29% identity, 93% coverage: 6:251/265 of query aligns to 4:247/262 of 2qflA
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
29% identity, 95% coverage: 1:251/265 of query aligns to 3:251/270 of 6ib8B
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
29% identity, 93% coverage: 6:251/265 of query aligns to 4:247/267 of P0ADG4
Sites not aligning to the query:
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 89% coverage: 1:236/265 of query aligns to 1:232/260 of P95189
6tqoT Rrn anti-termination complex (see paper)
30% identity, 82% coverage: 35:251/265 of query aligns to 21:239/255 of 6tqoT
2p3nA Thermotoga maritima impase tm1415 (see paper)
30% identity, 74% coverage: 41:235/265 of query aligns to 38:219/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
30% identity, 74% coverage: 41:235/265 of query aligns to 38:219/256 of O33832
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
31% identity, 88% coverage: 3:236/265 of query aligns to 1:230/256 of 5zonA
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
31% identity, 88% coverage: 4:236/265 of query aligns to 1:229/255 of 5yhtA
O14732 Inositol monophosphatase 2; IMP 2; IMPase 2; Inositol-1(or 4)-monophosphatase 2; Myo-inositol monophosphatase A2; EC 3.1.3.25 from Homo sapiens (Human) (see 2 papers)
27% identity, 87% coverage: 3:233/265 of query aligns to 16:247/288 of O14732
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
29% identity, 82% coverage: 13:230/265 of query aligns to 11:229/266 of 1imdA
6zk0AAA human impase with ebselen (see paper)
29% identity, 82% coverage: 13:230/265 of query aligns to 12:230/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
29% identity, 82% coverage: 13:230/265 of query aligns to 13:231/274 of 4as4A
6giuA Human impase with l-690330 (see paper)
29% identity, 82% coverage: 13:230/265 of query aligns to 13:231/275 of 6giuA
P29218 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Homo sapiens (Human) (see 5 papers)
29% identity, 82% coverage: 13:230/265 of query aligns to 15:233/277 of P29218
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
29% identity, 82% coverage: 13:230/265 of query aligns to 11:229/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
29% identity, 82% coverage: 13:230/265 of query aligns to 11:229/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
29% identity, 82% coverage: 13:230/265 of query aligns to 11:229/272 of 1awbA
4as5A Structure of mouse inositol monophosphatase 1 (see paper)
27% identity, 82% coverage: 13:230/265 of query aligns to 13:231/274 of 4as5A
>GFF3397 FitnessBrowser__Phaeo:GFF3397
MTYDDLIPVIRRLAIEAGEKIMEIYNSDEFEVKVKSDESPVTAADEAADALISAGLRAAF
PDVMLVTEEQADSHSKSGDTFLIVDPLDGTKEFIHRRGDFTVNIALVEKGVPTRGVVYAP
ARSRMFFTLADGSAVEETGAFDPAAMGEIKPIRVADSNNDALMVVASKSHRDQATDDYIN
KYAVKDSKSAGSSLKFCLVATGEADLYPRVGRTMEWDTAAGHAVLGGAGGQVVRFDDHAP
LTYGKEGYANPFFIAYAPGVELKKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory