SitesBLAST
Comparing GFF3422 FitnessBrowser__Phaeo:GFF3422 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6torB Human o-phosphoethanolamine phospho-lyase (see paper)
41% identity, 40% coverage: 605:1009/1009 of query aligns to 1:400/404 of 6torB
5g4jA Phospholyase a1rdf1 from arthrobacter in complex with phosphoethanolamine (see paper)
41% identity, 42% coverage: 585:1006/1009 of query aligns to 2:421/423 of 5g4jA
- active site: S14 (≠ L597), Y130 (= Y713), D201 (≠ E788), D234 (= D821), Q237 (= Q824), K264 (= K851), T294 (= T881), K395 (= K980)
- binding {5-hydroxy-6-methyl-4-[(E)-{[2-(phosphonooxy)ethyl]imino}methyl]pyridin-3-yl}methyl dihydrogen phosphate: Y44 (= Y627), R73 (= R656), G103 (= G686), S104 (≠ T687), Y130 (= Y713), H131 (= H714), D234 (= D821), V236 (= V823), Q237 (= Q824), K264 (= K851), T294 (= T881), R397 (= R982)
5g4iA Plp-dependent phospholyase a1rdf1 from arthrobacter aurescens tc1 (see paper)
41% identity, 42% coverage: 585:1006/1009 of query aligns to 2:421/423 of 5g4iA
- active site: S14 (≠ L597), Y130 (= Y713), D201 (≠ E788), D234 (= D821), Q237 (= Q824), K264 (= K851), T294 (= T881), K395 (= K980)
- binding pyridoxal-5'-phosphate: G103 (= G686), S104 (≠ T687), H131 (= H714), D234 (= D821), V236 (= V823), Q237 (= Q824), K264 (= K851)
- binding phosphate ion: Y44 (= Y627), R397 (= R982)
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
29% identity, 40% coverage: 605:1004/1009 of query aligns to 21:387/387 of 1wkhA
- active site: F132 (≠ Y713), E184 (= E788), D217 (= D821), Q220 (= Q824), K246 (= K851), T275 (= T881), R363 (≠ K980)
- binding 4-[(1,3-dicarboxy-propylamino)-methyl]-3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridinium: Y46 (vs. gap), S104 (= S685), G105 (= G686), T106 (= T687), F132 (≠ Y713), S133 (≠ H714), E184 (= E788), E189 (≠ V793), D217 (= D821), I219 (≠ V823), K246 (= K851), R363 (≠ K980)
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
29% identity, 40% coverage: 605:1004/1009 of query aligns to 21:387/387 of 1wkgA
- active site: F132 (≠ Y713), E184 (= E788), D217 (= D821), Q220 (= Q824), K246 (= K851), T275 (= T881), R363 (≠ K980)
- binding n~2~-acetyl-n~5~-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-l-ornithine: Y46 (vs. gap), G105 (= G686), T106 (= T687), F132 (≠ Y713), S133 (≠ H714), R135 (≠ N716), E184 (= E788), D217 (= D821), I219 (≠ V823), Q220 (= Q824), K246 (= K851), G273 (≠ F879), T274 (≠ S880), T275 (= T881)
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
29% identity, 40% coverage: 605:1004/1009 of query aligns to 21:387/387 of 1vefA
- active site: F132 (≠ Y713), D217 (= D821), K246 (= K851), T275 (= T881), R363 (≠ K980)
- binding pyridoxal-5'-phosphate: G105 (= G686), T106 (= T687), F132 (≠ Y713), S133 (≠ H714), E184 (= E788), D217 (= D821), I219 (≠ V823), K246 (= K851)
Sites not aligning to the query:
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
29% identity, 40% coverage: 605:1004/1009 of query aligns to 29:395/395 of Q5SHH5
- GT 113:114 (= GT 686:687) binding
- K254 (= K851) modified: N6-(pyridoxal phosphate)lysine
- T283 (= T881) binding
1zobA Crystal structure of dialkylglycine decarboxylases bound with calcium ion
32% identity, 39% coverage: 603:999/1009 of query aligns to 23:423/431 of 1zobA
- active site: W136 (≠ Y713), E208 (= E788), D241 (= D821), Q244 (= Q824), K270 (= K851), T301 (= T881), R404 (≠ K980)
- binding calcium ion: L76 (vs. gap), S78 (≠ T655), V303 (≠ G883), S304 (≠ G884), D305 (≠ S885)
- binding pyridoxal-5'-phosphate: T108 (≠ S685), A110 (≠ T687), N113 (= N690), W136 (≠ Y713), H137 (= H714), E208 (= E788), D241 (= D821), A243 (≠ V823), Q244 (= Q824), K270 (= K851)
Sites not aligning to the query:
1zc9A The crystal structure of dialkylglycine decarboxylase complex with pyridoxamine 5-phosphate (see paper)
32% identity, 39% coverage: 603:999/1009 of query aligns to 23:423/431 of 1zc9A
- active site: W136 (≠ Y713), E208 (= E788), D241 (= D821), Q244 (= Q824), K270 (= K851), T301 (= T881), R404 (≠ K980)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G109 (= G686), A110 (≠ T687), W136 (≠ Y713), H137 (= H714), E208 (= E788), D241 (= D821), A243 (≠ V823), Q244 (= Q824), K270 (= K851)
Sites not aligning to the query:
1m0qA Structure of dialkylglycine decarboxylase complexed with s-1- aminoethanephosphonate (see paper)
32% identity, 39% coverage: 603:999/1009 of query aligns to 23:423/431 of 1m0qA
- active site: W136 (≠ Y713), E208 (= E788), D241 (= D821), Q244 (= Q824), K270 (= K851), T301 (= T881), R404 (≠ K980)
- binding (1s)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]ethylphosphonic acid: Q50 (≠ V630), T108 (≠ S685), A110 (≠ T687), W136 (≠ Y713), H137 (= H714), E208 (= E788), S213 (≠ V793), D241 (= D821), A243 (≠ V823), Q244 (= Q824), K270 (= K851), R404 (≠ K980)
Sites not aligning to the query:
1m0pA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- phenylethanephosphonate (see paper)
32% identity, 39% coverage: 603:999/1009 of query aligns to 23:423/431 of 1m0pA
- active site: W136 (≠ Y713), E208 (= E788), D241 (= D821), Q244 (= Q824), K270 (= K851), T301 (= T881), R404 (≠ K980)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-phenylethylphosphonic acid: Q50 (≠ V630), T108 (≠ S685), A110 (≠ T687), W136 (≠ Y713), H137 (= H714), E208 (= E788), S213 (≠ V793), D241 (= D821), A243 (≠ V823), Q244 (= Q824), K270 (= K851), R404 (≠ K980)
Sites not aligning to the query:
1m0oA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- methylpropanephosphonate (see paper)
32% identity, 39% coverage: 603:999/1009 of query aligns to 23:423/431 of 1m0oA
- active site: W136 (≠ Y713), E208 (= E788), D241 (= D821), Q244 (= Q824), K270 (= K851), T301 (= T881), R404 (≠ K980)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-methylpropylphosphonic acid: Q50 (≠ V630), G109 (= G686), A110 (≠ T687), W136 (≠ Y713), H137 (= H714), E208 (= E788), D241 (= D821), Q244 (= Q824), K270 (= K851), R404 (≠ K980)
Sites not aligning to the query:
1m0nA Structure of dialkylglycine decarboxylase complexed with 1- aminocyclopentanephosphonate (see paper)
32% identity, 39% coverage: 603:999/1009 of query aligns to 23:423/431 of 1m0nA
- active site: W136 (≠ Y713), E208 (= E788), D241 (= D821), Q244 (= Q824), K270 (= K851), T301 (= T881), R404 (≠ K980)
- binding 1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]cyclopentylphosphonic acid: Q50 (≠ V630), M51 (≠ P631), A110 (≠ T687), N113 (= N690), W136 (≠ Y713), H137 (= H714), E208 (= E788), S213 (≠ V793), D241 (= D821), A243 (≠ V823), Q244 (= Q824), K270 (= K851), R404 (≠ K980)
Sites not aligning to the query:
1d7vA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with nma (see paper)
31% identity, 42% coverage: 580:999/1009 of query aligns to 2:423/431 of 1d7vA
- active site: G19 (= G594), W136 (≠ Y713), E208 (= E788), D241 (= D821), Q244 (= Q824), K270 (= K851), T301 (= T881), R404 (≠ K980)
- binding potassium ion: H75 (≠ S653), L76 (vs. gap), F77 (≠ N654), S78 (≠ T655), T301 (= T881), H302 (≠ F882), V303 (≠ G883), S304 (≠ G884), D305 (≠ S885)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-2-methylalanine: A110 (≠ T687), W136 (≠ Y713), H137 (= H714), E208 (= E788), S213 (≠ V793), D241 (= D821), A243 (≠ V823), Q244 (= Q824), K270 (= K851), R404 (≠ K980)
1d7uA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with lcs (see paper)
31% identity, 42% coverage: 580:999/1009 of query aligns to 2:423/431 of 1d7uA
- active site: G19 (= G594), W136 (≠ Y713), E208 (= E788), D241 (= D821), Q244 (= Q824), K270 (= K851), T301 (= T881), R404 (≠ K980)
- binding potassium ion: H75 (≠ S653), L76 (vs. gap), F77 (≠ N654), S78 (≠ T655), T301 (= T881), H302 (≠ F882), V303 (≠ G883), S304 (≠ G884), D305 (≠ S885)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G109 (= G686), A110 (≠ T687), W136 (≠ Y713), H137 (= H714), E208 (= E788), D241 (= D821), A243 (≠ V823), Q244 (= Q824), K270 (= K851), R404 (≠ K980)
1d7sA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with dcs (see paper)
31% identity, 42% coverage: 580:999/1009 of query aligns to 2:423/431 of 1d7sA
- active site: G19 (= G594), W136 (≠ Y713), E208 (= E788), D241 (= D821), Q244 (= Q824), K270 (= K851), T301 (= T881), R404 (≠ K980)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Q50 (≠ V630), G109 (= G686), A110 (≠ T687), W136 (≠ Y713), H137 (= H714), E208 (= E788), D241 (= D821), A243 (≠ V823), Q244 (= Q824), K270 (= K851), R404 (≠ K980)
- binding potassium ion: H75 (≠ S653), L76 (vs. gap), F77 (≠ N654), S78 (≠ T655), T301 (= T881), H302 (≠ F882), V303 (≠ G883), S304 (≠ G884), D305 (≠ S885)
1d7rA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with 5pa (see paper)
31% identity, 42% coverage: 580:999/1009 of query aligns to 2:423/431 of 1d7rA
- active site: G19 (= G594), W136 (≠ Y713), E208 (= E788), D241 (= D821), Q244 (= Q824), K270 (= K851), T301 (= T881), R404 (≠ K980)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: G109 (= G686), A110 (≠ T687), W136 (≠ Y713), H137 (= H714), E208 (= E788), S213 (≠ V793), D241 (= D821), A243 (≠ V823), Q244 (= Q824), K270 (= K851), R404 (≠ K980)
- binding potassium ion: H75 (≠ S653), L76 (vs. gap), F77 (≠ N654), S78 (≠ T655), T301 (= T881), H302 (≠ F882), V303 (≠ G883), S304 (≠ G884), D305 (≠ S885)
1dgdA An alkali metal ion size-dependent switch in the active site structure of dialkylglycine decarboxylase (see paper)
32% identity, 39% coverage: 603:999/1009 of query aligns to 23:423/431 of 1dgdA
- active site: W136 (≠ Y713), E208 (= E788), D241 (= D821), Q244 (= Q824), K270 (= K851), T301 (= T881), R404 (≠ K980)
- binding pyridoxal-5'-phosphate: T108 (≠ S685), G109 (= G686), A110 (≠ T687), W136 (≠ Y713), H137 (= H714), E208 (= E788), D241 (= D821), A243 (≠ V823), Q244 (= Q824), K270 (= K851)
Sites not aligning to the query:
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
28% identity, 41% coverage: 598:1008/1009 of query aligns to 25:448/448 of 6io1B
- active site: Y151 (= Y713), D257 (= D821), K286 (= K851)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (≠ S685), G118 (= G686), A119 (≠ T687), N122 (= N690), Y151 (= Y713), H152 (= H714), D257 (= D821), V259 (= V823), I260 (≠ Q824), K286 (= K851)
Sites not aligning to the query:
6gioC Structure of amino acid amide racemase from ochrobactrum anthropi (see paper)
30% identity, 40% coverage: 604:1008/1009 of query aligns to 24:424/436 of 6gioC
- active site: Y138 (= Y713), D237 (= D821), K266 (= K851)
- binding pyridoxal-5'-phosphate: S110 (= S685), G111 (= G686), S112 (≠ T687), Y138 (= Y713), H139 (= H714), E204 (= E788), D237 (= D821), V239 (= V823), K240 (≠ Q824), K266 (= K851), Q293 (≠ S880), T294 (= T881)
Sites not aligning to the query:
Query Sequence
>GFF3422 FitnessBrowser__Phaeo:GFF3422
MTAIHLAEDHWAAVLHDHWGIHAELSRLDGEYDLNYRALTPDGQGYILKAMRPGCVSDLV
DMQIAALAHLQNTDPGLPVPRTVAASNGELCLSLQDDTGEDRLVWVQTLLPGRCYAKSAP
KSAELIREIGATLAGTTRALKDFVHPALERRFKWDLMTADWITDDITCIADDSRQQLIAE
ICADFSSLKPQLEALPRQAIHNDANDYNILVTGELSEPRVVSGLIDLGDMCAAPRICDLA
IAAAYVVLDHPQPQRALAALVSGYHSVTPLTEEELGLLWPLLRMRLAVSVVNSTLEAKEN
PDDPYVTISQEPAWRFLDQPSEHPALITARLRATCGLTVVDGTDRVLAYLETHSGDFFPL
MGRDLTDFPMGSLSVEESTWPQNPFDMPLAEAAEVGQEFSGANGANWWLGYYREPRLIYT
APAFRKGEYLASDRRTVHLAVDVFAPAGQPLHAPLAGEVQVVEDRANHLDYGGVVILKHH
TDSGDAFYTLYGHLDPECCTRLSVGDKIAKGAPFCQLGTADQNGGWAPHVHFQLALSTEG
IEADWPGVADPDDLALWTALCPNPAPLLNLPAAQVSYQPTDKSTVLAGRRAHFGGNLSLT
YRDPVMLLRGWKHHLFDEWGRPYLDAYNNVPHVGHAHPRIQAIAADQLKRMNSNTRYLHP
AQNAFAEKILSKMPDHLEVCFFVNSGTEANELALRLARAHTGAKGMVTPDHGYHGNTTGA
IDISAYKFNAKGGVGPSDWVELVEVADDYRGTYGRDDPQRAQKYADLVDPAIAKLQASGH
GVAGFIAETFPSVGGQIIPPKGYLPAVYEKIRAAGGICIADEVQTGLGRLGEYYFGFEHQ
GASPDIVVLGKPIGNGHPLGVLVTTRAIADSFAQGPEFFSTFGGSTLSCRIGTEVLNIVD
EEGLQENARQRGADLLNGLRDLQSRHQAIGDVRGMGLFIGVELIRTDGSEASEICAYVKN
RMRDHRILIGSEGPKDNILKIRPPLTIDAEGIEMILKTLDSILSELSDS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory