SitesBLAST
Comparing GFF3433 FitnessBrowser__WCS417:GFF3433 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6jifB Crystal structures of branched-chain aminotransferase from pseudomonas sp. Uw4 (see paper)
88% identity, 99% coverage: 6:339/339 of query aligns to 1:334/334 of 6jifB
- binding pyridoxal-5'-phosphate: R77 (= R82), R169 (= R174), K179 (= K184), Y184 (= Y189), E215 (= E220), S218 (= S223), A219 (= A224), N220 (= N225), L239 (= L244), G241 (= G246), I242 (= I247), T243 (= T248), G279 (= G284), T280 (= T285)
3uzoA Crystal structures of branched-chain aminotransferase from deinococcus radiodurans complexes with alpha-ketoisocaproate and l-glutamate suggest its radio-resistance for catalysis (see paper)
73% identity, 99% coverage: 6:339/339 of query aligns to 1:335/335 of 3uzoA
- active site: K179 (= K184)
- binding glutamic acid: Y48 (= Y53), F53 (= F58), R122 (= R127), V134 (= V139), Y152 (= Y157), T281 (= T285), A282 (= A286)
- binding pyridoxal-5'-phosphate: R77 (= R82), K179 (= K184), Y184 (= Y189), E215 (= E220), G217 (= G222), A218 (≠ S223), A219 (= A224), N220 (= N225), L240 (= L244), S242 (≠ G246), I243 (= I247), T244 (= T248), G280 (= G284), T281 (= T285)
3uzbA Crystal structures of branched-chain aminotransferase from deinococcus radiodurans complexes with alpha-ketoisocaproate and l-glutamate suggest its radio-resistance for catalysis (see paper)
73% identity, 99% coverage: 6:339/339 of query aligns to 1:335/335 of 3uzbA
- active site: K179 (= K184)
- binding 2-oxo-4-methylpentanoic acid: Y120 (= Y125), K179 (= K184), T281 (= T285), A282 (= A286)
- binding pyridoxal-5'-phosphate: R77 (= R82), K179 (= K184), Y184 (= Y189), E215 (= E220), G217 (= G222), A218 (≠ S223), A219 (= A224), N220 (= N225), S242 (≠ G246), I243 (= I247), T244 (= T248), G280 (= G284), T281 (= T285)
3uyyB Crystal structures of branched-chain aminotransferase from deinococcus radiodurans complexes with alpha-ketoisocaproate and l-glutamate suggest its radio-resistance for catalysis (see paper)
73% identity, 99% coverage: 6:339/339 of query aligns to 3:337/337 of 3uyyB
- active site: K181 (= K184)
- binding pyridoxal-5'-phosphate: R79 (= R82), R171 (= R174), K181 (= K184), Y186 (= Y189), E217 (= E220), G219 (= G222), A220 (≠ S223), A221 (= A224), S244 (≠ G246), I245 (= I247), T246 (= T248), G282 (= G284), T283 (= T285)
3ht5A Crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis (see paper)
40% identity, 91% coverage: 31:339/339 of query aligns to 17:334/335 of 3ht5A
- active site: K171 (= K184)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R68 (= R82), K171 (= K184), Y176 (= Y189), E207 (= E220), G210 (≠ S223), M211 (≠ A224), N212 (= N225), L235 (= L244), G237 (= G246), I238 (= I247), T239 (= T248), T281 (= T285)
3dtgA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design
41% identity, 91% coverage: 31:339/339 of query aligns to 45:362/363 of 3dtgA
- active site: K199 (= K184)
- binding O-benzylhydroxylamine: F72 (= F58), Y171 (= Y157), Y204 (= Y189)
- binding pyridoxal-5'-phosphate: R96 (= R82), R189 (= R174), K199 (= K184), Y204 (= Y189), E235 (= E220), G238 (≠ S223), L263 (= L244), I266 (= I247), T267 (= T248), T309 (= T285)
3dtfA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design (see paper)
41% identity, 91% coverage: 31:339/339 of query aligns to 45:362/363 of 3dtfA
A0R066 Branched-chain-amino-acid aminotransferase; BCAT; EC 2.6.1.42 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see 2 papers)
41% identity, 91% coverage: 31:339/339 of query aligns to 50:367/368 of A0R066
- R101 (= R82) binding
- Y209 (= Y189) binding
- K299 (≠ Q276) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- T314 (= T285) binding
5u3fA Structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative (see paper)
38% identity, 91% coverage: 31:339/339 of query aligns to 16:325/326 of 5u3fA
- active site: K162 (= K184)
- binding (5-hydroxy-6-methyl-4-{[(3-oxo-2,3-dihydro-1,2-oxazol-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: G45 (= G60), R67 (= R82), Y110 (= Y125), K162 (= K184), Y167 (= Y189), E198 (= E220), G201 (≠ S223), M202 (≠ A224), N203 (= N225), L226 (= L244), G228 (= G246), I229 (= I247), T230 (= T248), T272 (= T285)
7nwmA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 12 (see paper)
32% identity, 97% coverage: 9:337/339 of query aligns to 24:362/365 of 7nwmA
- binding pyridoxal-5'-phosphate: R98 (= R82), R191 (= R174), K201 (= K184), Y206 (= Y189), E236 (= E220), T239 (≠ S223), M240 (≠ A224), L265 (= L244), G267 (= G246), V268 (≠ I247), T269 (= T248), G311 (= G284), T312 (= T285)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-methoxy-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F13), Y69 (= Y53), F74 (= F58), Y140 (= Y125), G153 (= G138), V154 (= V139), Y172 (= Y157), Q213 (≠ G196), Q223 (≠ D206), T239 (≠ S223), A313 (= A286)
7nweA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 10 (see paper)
32% identity, 97% coverage: 9:337/339 of query aligns to 24:362/365 of 7nweA
- binding pyridoxal-5'-phosphate: R98 (= R82), K201 (= K184), Y206 (= Y189), E236 (= E220), T239 (≠ S223), M240 (≠ A224), L265 (= L244), G267 (= G246), V268 (≠ I247), T269 (= T248), G311 (= G284), T312 (= T285)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-methyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F13), Y69 (= Y53), F74 (= F58), Y140 (= Y125), G153 (= G138), V154 (= V139), Y172 (= Y157), Q213 (≠ G196), Q223 (≠ D206), T239 (≠ S223), A313 (= A286)
7nwcA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 2 (see paper)
32% identity, 97% coverage: 9:337/339 of query aligns to 24:362/365 of 7nwcA
- binding pyridoxal-5'-phosphate: R98 (= R82), R191 (= R174), K201 (= K184), Y206 (= Y189), E236 (= E220), T239 (≠ S223), M240 (≠ A224), N241 (= N225), L265 (= L244), G267 (= G246), V268 (≠ I247), T269 (= T248), G311 (= G284), T312 (= T285)
- binding 3-(5-chloranyl-2,4-dimethoxy-phenyl)-6-(trifluoromethyl)-1H-pyrimidine-2,4-dione: F28 (= F13), Y172 (= Y157), Q223 (≠ D206), T239 (≠ S223), A313 (= A286)
7nwbA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 1 (see paper)
32% identity, 97% coverage: 9:337/339 of query aligns to 24:362/365 of 7nwbA
- binding pyridoxal-5'-phosphate: R98 (= R82), R191 (= R174), K201 (= K184), Y206 (= Y189), E236 (= E220), T239 (≠ S223), M240 (≠ A224), L265 (= L244), G267 (= G246), V268 (≠ I247), T269 (= T248), G311 (= G284), T312 (= T285)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-fluoranyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F13), Y69 (= Y53), F74 (= F58), Y140 (= Y125), G153 (= G138), V154 (= V139), Y172 (= Y157), Q213 (≠ G196), Q223 (≠ D206), A313 (= A286)
7nwaA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and compound a (see paper)
32% identity, 97% coverage: 9:337/339 of query aligns to 24:362/365 of 7nwaA
- binding pyridoxal-5'-phosphate: R98 (= R82), K201 (= K184), Y206 (= Y189), E236 (= E220), T239 (≠ S223), N241 (= N225), L265 (= L244), G267 (= G246), V268 (≠ I247), T269 (= T248), T312 (= T285)
- binding 2-[[4-chloranyl-2,6-bis(fluoranyl)phenyl]methylamino]-7-oxidanylidene-5-propyl-4H-pyrazolo[1,5-a]pyrimidine-3-carbonitrile: R142 (= R127), G153 (= G138), V154 (= V139), Y172 (= Y157), F173 (= F158), V181 (≠ H165), Q223 (≠ D206), V237 (= V221), T239 (≠ S223), M240 (≠ A224), G311 (= G284), A313 (= A286), C317 (≠ S290)
7nyaA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor bay-069 (compound 36) (see paper)
32% identity, 97% coverage: 9:337/339 of query aligns to 23:361/364 of 7nyaA
- binding pyridoxal-5'-phosphate: R97 (= R82), R190 (= R174), K200 (= K184), Y205 (= Y189), E235 (= E220), T238 (≠ S223), M239 (≠ A224), L264 (= L244), G266 (= G246), V267 (≠ I247), T268 (= T248), G310 (= G284), T311 (= T285)
- binding 3-[4-chloranyl-3-(2-methylphenoxy)naphthalen-1-yl]-6-(trifluoromethyl)-5~{H}-pyrimidine-2,4-dione: F27 (= F13), Y68 (= Y53), F73 (= F58), Y139 (= Y125), G152 (= G138), V153 (= V139), Y171 (= Y157), Q212 (≠ G196), Q222 (≠ D206), T238 (≠ S223), A312 (= A286)
7ny9A Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 38 (see paper)
32% identity, 97% coverage: 9:337/339 of query aligns to 23:361/364 of 7ny9A
- binding pyridoxal-5'-phosphate: R97 (= R82), R190 (= R174), K200 (= K184), Y205 (= Y189), E235 (= E220), T238 (≠ S223), M239 (≠ A224), N240 (= N225), L264 (= L244), G266 (= G246), V267 (≠ I247), T268 (= T248), T311 (= T285)
- binding 3-[2,6-bis(oxidanylidene)-4-(trifluoromethyl)-5~{H}-pyrimidin-1-yl]-~{N}-methyl-2-pyridin-2-yl-imidazo[1,2-a]pyridine-7-carboxamide: F27 (= F13), Y139 (= Y125), G152 (= G138), V153 (= V139), Y171 (= Y157), Q212 (≠ G196), Q221 (≠ A205), Q222 (≠ D206), V223 (≠ A207), T238 (≠ S223)
7ny2A Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 35 (see paper)
32% identity, 97% coverage: 9:337/339 of query aligns to 23:361/364 of 7ny2A
- binding pyridoxal-5'-phosphate: R97 (= R82), K200 (= K184), Y205 (= Y189), E235 (= E220), T238 (≠ S223), M239 (≠ A224), L264 (= L244), G266 (= G246), V267 (≠ I247), T268 (= T248), T311 (= T285)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-2-(2-methylphenoxy)naphthalene-1-carbonitrile: F27 (= F13), Y139 (= Y125), G152 (= G138), V153 (= V139), Y171 (= Y157), Q212 (≠ G196), Q222 (≠ D206), A312 (= A286)
2abjA Crystal structure of human branched chain amino acid transaminase in a complex with an inhibitor, c16h10n2o4f3scl, and pyridoxal 5' phosphate. (see paper)
32% identity, 95% coverage: 9:331/339 of query aligns to 25:359/366 of 2abjA
- active site: K202 (= K184)
- binding n'-(5-chlorobenzofuran-2-carbonyl)-2-(trifluoromethyl)benzenesulfonohydrazide: F29 (= F13), F75 (= F58), Y141 (= Y125), Y173 (= Y157), K202 (= K184), Q224 (≠ D206), T240 (≠ S223), M241 (≠ A224), G312 (= G284), A314 (= A286), C315 (≠ A287)
- binding pyridoxal-5'-phosphate: R99 (= R82), R192 (= R174), K202 (= K184), Y207 (= Y189), E237 (= E220), T240 (≠ S223), M241 (≠ A224), N242 (= N225), L266 (= L244), G268 (= G246), V269 (≠ I247), T270 (= T248), T313 (= T285)
7nxoA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 24(5-f) (see paper)
32% identity, 97% coverage: 9:337/339 of query aligns to 23:358/361 of 7nxoA
- binding pyridoxal-5'-phosphate: R97 (= R82), K197 (= K184), Y202 (= Y189), E232 (= E220), T235 (≠ S223), M236 (≠ A224), N237 (= N225), L261 (= L244), G263 (= G246), V264 (≠ I247), T265 (= T248), T308 (= T285)
- binding 4-[2,4-bis(oxidanylidene)-6-(phenylsulfonyl)-1H-pyrimidin-3-yl]-5-fluoranyl-2-(2-methylphenoxy)benzenecarbonitrile: F27 (= F13), Y68 (= Y53), F73 (= F58), G152 (= G138), V153 (= V139), Y171 (= Y157), F172 (= F158), Q209 (≠ G196), Q218 (≠ A205), Q219 (≠ D206), T235 (≠ S223)
7nxnA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 21(5-f) (see paper)
32% identity, 97% coverage: 9:337/339 of query aligns to 24:359/362 of 7nxnA
- binding pyridoxal-5'-phosphate: R98 (= R82), R188 (= R174), K198 (= K184), Y203 (= Y189), E233 (= E220), T236 (≠ S223), M237 (≠ A224), N238 (= N225), L262 (= L244), G264 (= G246), V265 (≠ I247), T266 (= T248), T309 (= T285)
- binding 4-[6-[bis(fluoranyl)-phenyl-methyl]-2,4-bis(oxidanylidene)-1~{H}-pyrimidin-3-yl]-5-fluoranyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F13), Y69 (= Y53), F74 (= F58), G153 (= G138), V154 (= V139), Y172 (= Y157), Q210 (≠ G196), Q219 (≠ A205), Q220 (≠ D206), T236 (≠ S223)
Query Sequence
>GFF3433 FitnessBrowser__WCS417:GFF3433
MGNESINWDKLGFDYIKTDKRFLQVWKNGEWQAGTLTDDNVLHISEGSTALHYGQQCFEG
LKAYRCKDGSINLFRPDQNAARMQRSCARLLMPHVPTEVFIDACKQVVKANEHFIPPYGS
GGALYLRPFVIGTGDNIGVRTAPEFIFSVFCIPVGAYFKGGLVPHNFQISTFDRAAPQGT
GAAKVGGNYAASLMPGSEAKKSGFADAIYLDPMTHSKIEEVGSANFFGITHDNKFITPKS
PSVLPGITRLSLIELAKTRLGLEVVEGEVFIDKLDQFKEAGACGTAAVISPIGGIQYNGK
LHVFHSETEVGPITQKLYKELTGVQTGDVEAPQGWIVKV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory