SitesBLAST – Find functional sites

 

SitesBLAST

Comparing GFF3438 FitnessBrowser__WCS417:GFF3438 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 2 hits to proteins with known functional sites (download)

4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
30% identity, 88% coverage: 20:227/237 of query aligns to 16:213/214 of 4ymwC

query
sites
4ymwC
L
 
I
S
 
S
G
 
G
V
 
L
A
 
I
M
 
M
T
 
T
L
 
L
W
 
K
L
 
L
F
 
T
I
 
F
I
 
L
S
 
A
V
 
V
V
 
T
L
 
I
G
 
G
F
 
V
F
 
L
L
 
M
S
 
G
I
 
L
P
 
F
L
 
I
A
 
A
L
 
L
A
 
M
R
 
K
V
 
M
S
 
S
E
 
S
H
 
I
V
 
K
W
 
P
L
 
I
R
 
K
W
 
L
P
 
V
V
 
A
E
 
S
V
 
S
Y
 
Y
T
 
I
Y
 
E
L
 
V
F
 
I
R
 
R
G
 
G
T
 
T
P
 
P
L
|
L
Y
 
L
I
 
V
Q
 
Q
L
 
L
L
 
L
I
 
L
C
 
I
Y
 
Y
T
 
N
G
 
G
L
 
L
Y
 
M
S
 
-
L
 
-
E
 
-
I
 
-
V
 
-
Q
 
-
D
 
-
N
 
-
A
 
-
L
 
-
L
 
-
N
 
-
Q
 
Q
F
 
F
F
 
G
R
 
M
N
 
N
-
 
I
-
 
P
A
 
A
L
 
F
N
 
T
C
 
A
T
 
G
L
 
V
L
 
S
A
 
A
F
 
L
V
 
A
L
 
I
N
|
N
T
 
S
C
 
S
A
 
A
Y
|
Y
T
 
V
V
 
A
E
 
E
I
 
I
F
 
I
A
 
R
G
 
A
A
 
G
I
 
I
R
 
Q
N
 
A
I
 
V
P
 
D
H
 
P
G
 
G
E
 
Q
I
 
N
E
 
E
A
 
A
A
 
A
R
 
R
A
 
S
Y
 
L
G
 
G
L
 
M
H
 
T
G
 
H
W
 
A
R
 
M
L
 
A
N
 
M
L
 
R
F
 
Y
V
 
V
V
 
I
V
 
I
P
 
P
A
 
Q
A
 
A
L
 
I
R
 
K
R
 
N
A
 
I
L
 
L
P
 
P
A
 
A
Y
 
L
S
 
G
N
 
N
E
|
E
M
 
F
I
 
I
L
 
V
M
|
M
L
 
L
H
 
K
A
x
E
T
 
S
S
 
A
L
 
I
A
 
V
F
 
S
T
 
V
A
 
I
T
 
G
V
 
F
A
 
A
D
 
D
I
 
L
L
 
T
K
 
R
V
 
Q
A
 
A
R
 
D
D
 
I
A
 
I
N
 
Q
A
 
S
E
 
V
T
 
T
F
 
Y
L
 
R
T
 
Y
F
 
F
Q
 
E
A
 
P
F
 
Y
G
 
I
I
 
I
A
 
I
A
 
A
L
 
A
L
 
I
Y
 
Y
M
 
F
L
 
V
L
 
M
S
 
T
F
 
L
A
 
T
L
 
F
V
 
S
G
 
K
L
 
L
F
 
L
R
 
S
L
 
L
A
 
F
E
 
E
R
 
R
R
 
R

4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
30% identity, 88% coverage: 20:227/237 of query aligns to 16:213/215 of 4ymtC

query
sites
4ymtC
L
 
I
S
 
S
G
 
G
V
 
L
A
 
I
M
 
M
T
 
T
L
 
L
W
 
K
L
 
L
F
 
T
I
 
F
I
 
L
S
 
A
V
 
V
V
 
T
L
 
I
G
 
G
F
 
V
F
 
L
L
 
M
S
 
G
I
 
L
P
 
F
L
 
I
A
 
A
L
 
L
A
 
M
R
 
K
V
 
M
S
 
S
E
 
S
H
 
I
V
 
K
W
 
P
L
 
I
R
 
K
W
 
L
P
 
V
V
 
A
E
 
S
V
 
S
Y
 
Y
T
 
I
Y
 
E
L
 
V
F
 
I
R
 
R
G
 
G
T
|
T
P
|
P
L
|
L
Y
 
L
I
 
V
Q
 
Q
L
 
L
L
 
L
I
 
L
C
 
I
Y
 
Y
T
 
N
G
 
G
L
 
L
Y
 
M
S
 
-
L
 
-
E
 
-
I
 
-
V
 
-
Q
 
-
D
 
-
N
 
-
A
 
-
L
 
-
L
 
-
N
 
-
Q
 
Q
F
 
F
F
 
G
R
 
M
N
 
N
-
 
I
-
 
P
A
 
A
L
 
F
N
 
T
C
 
A
T
 
G
L
 
V
L
 
S
A
 
A
F
 
L
V
 
A
L
 
I
N
|
N
T
x
S
C
 
S
A
 
A
Y
|
Y
T
 
V
V
 
A
E
 
E
I
 
I
F
 
I
A
 
R
G
 
A
A
 
G
I
 
I
R
 
Q
N
 
A
I
 
V
P
 
D
H
 
P
G
 
G
E
 
Q
I
 
N
E
 
E
A
 
A
A
 
A
R
 
R
A
 
S
Y
 
L
G
 
G
L
 
M
H
 
T
G
 
H
W
 
A
R
 
M
L
 
A
N
 
M
L
 
R
F
 
Y
V
 
V
V
 
I
V
 
I
P
 
P
A
 
Q
A
 
A
L
 
I
R
 
K
R
 
N
A
 
I
L
 
L
P
 
P
A
 
A
Y
 
L
S
 
G
N
 
N
E
|
E
M
 
F
I
 
I
L
 
V
M
|
M
L
 
L
H
x
K
A
x
E
T
 
S
S
 
A
L
 
I
A
 
V
F
 
S
T
 
V
A
 
I
T
 
G
V
 
F
A
 
A
D
 
D
I
 
L
L
 
T
K
 
R
V
 
Q
A
 
A
R
 
D
D
 
I
A
 
I
N
 
Q
A
 
S
E
 
V
T
 
T
F
 
Y
L
 
R
T
 
Y
F
 
F
Q
 
E
A
 
P
F
 
Y
G
 
I
I
 
I
A
 
I
A
 
A
L
 
A
L
 
I
Y
 
Y
M
 
F
L
 
V
L
 
M
S
 
T
F
 
L
A
 
T
L
 
F
V
 
S
G
 
K
L
 
L
F
 
L
R
 
S
L
 
L
A
 
F
E
 
E
R
 
R
R
 
R

Query Sequence

>GFF3438 FitnessBrowser__WCS417:GFF3438
MIELFQQYGLAYLFSDGAGLSGVAMTLWLFIISVVLGFFLSIPLALARVSEHVWLRWPVE
VYTYLFRGTPLYIQLLICYTGLYSLEIVQDNALLNQFFRNALNCTLLAFVLNTCAYTVEI
FAGAIRNIPHGEIEAARAYGLHGWRLNLFVVVPAALRRALPAYSNEMILMLHATSLAFTA
TVADILKVARDANAETFLTFQAFGIAALLYMLLSFALVGLFRLAERRWMRFLVPTRG

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory