SitesBLAST
Comparing GFF3445 FitnessBrowser__Phaeo:GFF3445 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8cqxA Ribokinase from t.Sp mutant a92g
38% identity, 99% coverage: 3:290/290 of query aligns to 2:299/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (= N179), T217 (= T205), G219 (= G207), A220 (= A208), G222 (= G210), F250 (= F241), N272 (= N263), G275 (≠ A266), A276 (= A267), T279 (≠ V270)
- binding magnesium ion: D242 (= D233), T244 (= T235), A278 (≠ M269), S287 (≠ V278)
6a8cA Ribokinase from leishmania donovani with adp (see paper)
32% identity, 98% coverage: 3:285/290 of query aligns to 16:322/327 of 6a8cA
- binding adenosine-5'-diphosphate: G245 (= G207), A246 (= A208), T271 (= T234), A274 (= A237), G275 (= G238), N300 (= N263), A303 (= A266)
- binding glycerol: D25 (= D12), S42 (≠ A29), S44 (≠ G31), G50 (= G37), G51 (= G38), N55 (= N42)
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
32% identity, 98% coverage: 3:285/290 of query aligns to 16:322/327 of 6a8bA
- binding phosphomethylphosphonic acid adenylate ester: G245 (= G207), A246 (= A208), T271 (= T234), A274 (= A237), G275 (= G238), N300 (= N263), A303 (= A266), V307 (= V270)
- binding glycerol: D25 (= D12), G50 (= G37), G51 (= G38), N55 (= N42), N157 (= N135), I159 (≠ T137), E190 (≠ D162)
6a8aA Ribokinase from leishmania donovani with atp (see paper)
32% identity, 98% coverage: 3:285/290 of query aligns to 16:322/327 of 6a8aA
- binding adenosine-5'-triphosphate: N207 (= N179), T243 (= T205), G245 (= G207), A246 (= A208), G248 (= G210), T271 (= T234), G273 (= G236), A274 (= A237), G275 (= G238), N300 (= N263), A303 (= A266), V307 (= V270)
- binding glycerol: D25 (= D12), G50 (= G37), G51 (= G38), N55 (= N42)
6xk2A Crystal structure of ribokinase from cryptococcus neoformans var. Grubii serotype a in complex with adp
32% identity, 97% coverage: 7:287/290 of query aligns to 10:318/320 of 6xk2A
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
33% identity, 97% coverage: 6:286/290 of query aligns to 7:299/306 of 4xckA
- active site: A249 (≠ G236), A250 (= A237), G251 (= G238), D252 (= D239)
- binding adenosine-5'-diphosphate: T220 (= T205), G222 (= G207), S223 (≠ A208), V242 (= V229), T247 (= T234), A250 (= A237), F254 (= F241), H276 (≠ N263), A279 (= A266), V283 (= V270)
- binding alpha-D-ribofuranose: N11 (= N10), D13 (= D12), G39 (= G38), K40 (= K39), N43 (= N42), A95 (= A91), I107 (= I103), I109 (≠ L105), E140 (= E136), T248 (= T235), D252 (= D239)
6znxC Ribokinase from thermus species
35% identity, 99% coverage: 3:290/290 of query aligns to 2:264/265 of 6znxC
P0DX97 Deoxyribokinase; dRK; ATP:2-deoxy-D-ribose 5-phosphotransferase; EC 2.7.1.229 from Salmonella typhi (see paper)
31% identity, 99% coverage: 1:287/290 of query aligns to 1:300/306 of P0DX97
- M10 (≠ N10) Important for substrate specificity; mutation to N: 2.5-fold decrease in Vmax for deoxyribokinase activity and 70-fold increase in KM for deoxyribose. 2-fold increase in KM for ribose.
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
32% identity, 97% coverage: 6:285/290 of query aligns to 7:298/305 of 1rk2A
- active site: A249 (≠ G236), A250 (= A237), G251 (= G238), D252 (= D239)
- binding adenosine-5'-diphosphate: T220 (= T205), G222 (= G207), S223 (≠ A208), A250 (= A237), G251 (= G238), H276 (≠ N263), A279 (= A266)
- binding tetrafluoroaluminate ion: G213 (= G198), R215 (≠ A200)
- binding magnesium ion: D246 (= D233), A282 (≠ M269), R285 (= R272), S291 (≠ V278)
- binding alpha-D-ribofuranose: N11 (= N10), D13 (= D12), G38 (= G37), G39 (= G38), K40 (= K39), N43 (= N42), E140 (= E136), D252 (= D239)
1gqtB Activation of ribokinase by monovalent cations (see paper)
32% identity, 97% coverage: 6:285/290 of query aligns to 9:300/307 of 1gqtB
- active site: A251 (≠ G236), A252 (= A237), G253 (= G238), D254 (= D239)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N179), T222 (= T205), G224 (= G207), S225 (≠ A208), A252 (= A237), G253 (= G238), H278 (≠ N263), A281 (= A266)
- binding cesium ion: D248 (= D233), I250 (≠ T235), A284 (≠ M269), R287 (= R272), S293 (≠ V278)
- binding alpha-D-ribofuranose: N13 (= N10), D15 (= D12), G41 (= G38), N45 (= N42), E142 (= E136), D254 (= D239)
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 97% coverage: 6:285/290 of query aligns to 10:301/309 of P0A9J6
2fv7A Crystal structure of human ribokinase
31% identity, 98% coverage: 2:285/290 of query aligns to 3:303/308 of 2fv7A
- active site: G252 (= G236), A253 (= A237), G254 (= G238), D255 (= D239)
- binding adenosine-5'-diphosphate: N185 (= N179), T221 (= T205), G223 (= G207), G226 (= G210), T242 (≠ A226), V245 (= V229), A253 (= A237), G254 (= G238), N281 (= N263), A284 (= A266), A285 (= A267), V288 (= V270)
5c3yA Structure of human ribokinase crystallized with amppnp
31% identity, 98% coverage: 2:285/290 of query aligns to 3:303/306 of 5c3yA
- active site: G252 (= G236), A253 (= A237), G254 (= G238), D255 (= D239)
- binding amp phosphoramidate: T221 (= T205), G223 (= G207), V245 (= V229), T250 (= T234), G254 (= G238), N281 (= N263), A284 (= A266), A285 (= A267)
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
31% identity, 98% coverage: 2:285/290 of query aligns to 4:304/311 of 6wk0B
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N179), T222 (= T205), G224 (= G207), A225 (= A208), G227 (= G210), T243 (≠ A226), V246 (= V229), A254 (= A237), G255 (= G238), N282 (= N263), A285 (= A266), A286 (= A267), V289 (= V270)
- binding alpha-D-ribofuranose: D14 (= D12), G40 (= G38), K41 (= K39), N44 (= N42), A96 (= A91), E141 (= E136), D256 (= D239)
5c41A Crystal structure of human ribokinase in complex with amppcp in p21 spacegroup and with 4 protomers
31% identity, 98% coverage: 2:285/290 of query aligns to 4:304/317 of 5c41A
- active site: G253 (= G236), A254 (= A237), G255 (= G238), D256 (= D239)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N179), T222 (= T205), G224 (= G207), A225 (= A208), G227 (= G210), V246 (= V229), G255 (= G238), N282 (= N263), A285 (= A266), A286 (= A267)
6wjzA Crystal structure of human ribokinase in complex with ampcp
31% identity, 98% coverage: 2:285/290 of query aligns to 4:304/315 of 6wjzA
- binding phosphomethylphosphonic acid adenosyl ester: N186 (= N179), T222 (= T205), G224 (= G207), A225 (= A208), G227 (= G210), T243 (≠ A226), V246 (= V229), A254 (= A237), G255 (= G238), N282 (= N263), A285 (= A266), A286 (= A267), V289 (= V270)
Q9H477 Ribokinase; RK; EC 2.7.1.15 from Homo sapiens (Human)
31% identity, 96% coverage: 7:285/290 of query aligns to 22:317/322 of Q9H477
5byfA Crystal structure of human ribokinase in complex with amp
32% identity, 96% coverage: 7:285/290 of query aligns to 10:305/313 of 5byfA
3i3yD Crystal structure of ribokinase in complex with d-ribose from klebsiella pneumoniae
31% identity, 98% coverage: 1:285/290 of query aligns to 1:280/285 of 3i3yD
3ikhA Crystal structure of ribokinase in complex with atp and glycerol in the active site from klebsiella pneumoniae
31% identity, 98% coverage: 1:285/290 of query aligns to 2:281/286 of 3ikhA
Query Sequence
>GFF3445 FitnessBrowser__Phaeo:GFF3445
MAIWNLGSINADMIYALPHMPTAGETLAATGLEQYLGGKGANMSVAAARAGSHVCHLGAV
GPEGAWAVTRLLEYGVDTRHIAQLDVPTGHAIIAVDPTGENQIILFPGANREISEDQIGA
ALSAASAGDILVMQNETNMQAEAAQMGRDLGLKVAYAAAPFDAAAVQAVLPYLDYLFLNE
VEAEQLRAATGKTPEALGVADVIVTLGAKGARHYDTTAGTTHDVAAHSVVPVDTTGAGDT
FTGYVLSGLDRGLPMAQALAQANRAAALMVTRKGTADVIPDLKEVQDARF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory