Comparing GFF3449 FitnessBrowser__psRCH2:GFF3449 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
54% identity, 96% coverage: 11:357/361 of query aligns to 3:351/352 of 1cjxA
7xntA Crystal structure of pfhppd-y13161 complex
54% identity, 94% coverage: 11:351/361 of query aligns to 6:341/341 of 7xntA
7x8eA Crystal structure of pfhppd-y13287 complex
52% identity, 96% coverage: 11:355/361 of query aligns to 5:341/341 of 7x8eA
7xntC Crystal structure of pfhppd-y13161 complex
50% identity, 93% coverage: 11:346/361 of query aligns to 5:320/320 of 7xntC
1t47A Structure of fe2-hppd bound to ntbc (see paper)
38% identity, 80% coverage: 63:351/361 of query aligns to 62:360/362 of 1t47A
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
38% identity, 90% coverage: 16:339/361 of query aligns to 296:611/624 of 5hmqD
Sites not aligning to the query:
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
36% identity, 90% coverage: 16:339/361 of query aligns to 294:614/635 of Q88JU3
Sites not aligning to the query:
P32755 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; F Alloantigen; F protein; EC 1.13.11.27 from Rattus norvegicus (Rat) (see 2 papers)
33% identity, 76% coverage: 80:355/361 of query aligns to 88:379/393 of P32755
Sites not aligning to the query:
5ec3A Structural insight into the catalyitc mechanism of human 4- hydroxyphenylpyruvate dioxygenase
33% identity, 76% coverage: 80:355/361 of query aligns to 80:371/376 of 5ec3A
8im2A Crystal structure of human hppd complexed with ntbc (see paper)
33% identity, 76% coverage: 80:355/361 of query aligns to 82:373/374 of 8im2A
8im3A Crystal structure of human hppd complexed with compound a10 (see paper)
32% identity, 75% coverage: 80:351/361 of query aligns to 82:369/371 of 8im3A
Q02110 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Sus scrofa (Pig) (see paper)
40% identity, 54% coverage: 161:355/361 of query aligns to 176:379/393 of Q02110
Sites not aligning to the query:
1sqiA Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases (see paper)
33% identity, 73% coverage: 80:342/361 of query aligns to 81:343/343 of 1sqiA
1sqiB Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases (see paper)
33% identity, 73% coverage: 80:342/361 of query aligns to 82:342/342 of 1sqiB
O52791 4-hydroxymandelate synthase; HMS; HmaS; 4-hydroxyphenylpyruvate dioxygenase II; EC 1.13.11.46 from Amycolatopsis orientalis (Nocardia orientalis) (see paper)
30% identity, 86% coverage: 38:348/361 of query aligns to 29:343/357 of O52791
2r5vA Hydroxymandelate synthase crystal structure (see paper)
30% identity, 86% coverage: 38:348/361 of query aligns to 28:341/346 of 2r5vA
7yvvA Acmp1, r-4-hydroxymandelate synthase
29% identity, 76% coverage: 76:351/361 of query aligns to 65:334/335 of 7yvvA
5ywhA Crystal structure of arabidopsis thaliana hppd complexed with y13508
32% identity, 77% coverage: 72:349/361 of query aligns to 91:371/372 of 5ywhA
5ywkA Crystal structure of arabidopsis thaliana hppd complexed with benquitrione-methyl (see paper)
33% identity, 77% coverage: 72:349/361 of query aligns to 91:371/372 of 5ywkA
5ywgA Crystal structure of arabidopsis thaliana hppd complexed with mesotrione (see paper)
33% identity, 77% coverage: 72:349/361 of query aligns to 89:365/366 of 5ywgA
>GFF3449 FitnessBrowser__psRCH2:GFF3449
MNAVNKIEQHNPIGTDGFEFVEFTAPNAEGIEQLRTLFTQMGFTETAKHRSKEVWLFQQH
DINIVLNGSPTGHVHAFAEKHGPSACAMAFRVKNAAQAAAYVESQGAKLVGSHANFGELN
IPCVEGIGGSLLYLVDRYGDKSIYDVDFEYIEGRTPNDNAVGLMCIDHLTHNVMRGQMDV
WSGFYERIANFREIRYFDIEGKLTGLFSRAMTAPCGKIRIPINESADDKSQIEEFIREYH
GEGIQHIALSTDDIYATVRQLRANGVDFMTTPDTYYEKVDTRVAGHGEPTDVLRELNILI
DGAPGDDGILLQIFTNTVIGPIFFEIIQRKGNQGFGEGNFKALFESIEEDQLRRGVIKAD
E
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory