SitesBLAST
Comparing GFF3450 FitnessBrowser__psRCH2:GFF3450 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6yu7A Crystal structure of mhst in complex with l-tyrosine (see paper)
43% identity, 94% coverage: 25:464/469 of query aligns to 2:439/442 of 6yu7A
6yu5A Crystal structure of mhst in complex with l-valine (see paper)
43% identity, 94% coverage: 25:464/469 of query aligns to 2:439/441 of 6yu5A
6yu4A Crystal structure of mhst in complex with l-4f-phenylalanine (see paper)
43% identity, 94% coverage: 25:464/469 of query aligns to 2:439/442 of 6yu4A
- binding 4-fluoro-l-phenylalanine: S18 (= S41), A19 (= A42), G21 (= G44), L22 (= L45), G23 (= G46), Y101 (= Y128), F223 (= F249), T224 (= T250), S226 (= S252), M229 (≠ C255), L321 (= L347)
6yu3A Crystal structure of mhst in complex with l-phenylalanine (see paper)
43% identity, 94% coverage: 25:464/469 of query aligns to 2:439/441 of 6yu3A
6yu2A Crystal structure of mhst in complex with l-isoleucine (see paper)
43% identity, 94% coverage: 25:464/469 of query aligns to 2:439/441 of 6yu2A
4us3A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (see paper)
43% identity, 94% coverage: 25:464/469 of query aligns to 2:439/441 of 4us3A
- binding sodium ion: G17 (= G40), A19 (= A42), V20 (= V43), V20 (= V43), G21 (= G44), N24 (= N47), T224 (= T250), D256 (= D282), A313 (= A339), S316 (≠ T342), S317 (= S343)
- binding tryptophan: S18 (= S41), A19 (= A42), L22 (= L45), G23 (= G46), Y101 (= Y128), F223 (= F249), T224 (= T250), S226 (= S252), M229 (≠ C255), S320 (= S346), L321 (= L347)
6yu6B Crystal structure of mhst in complex with l-leucine (see paper)
43% identity, 94% coverage: 25:464/469 of query aligns to 2:439/446 of 6yu6B
4us4A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (lipidic cubic phase form) (see paper)
43% identity, 92% coverage: 34:464/469 of query aligns to 2:430/433 of 4us4A
- binding (2s)-2,3-dihydroxypropyl(7z)-pentadec-7-enoate: A173 (≠ V209), T180 (≠ I216), I287 (≠ M322), R288 (≠ P323), L289 (= L324)
- binding sodium ion: G8 (= G40), S9 (= S41), A10 (= A42), V11 (= V43), V11 (= V43), N15 (= N47), T215 (= T250), D247 (= D282), A304 (= A339), S307 (≠ T342), S308 (= S343)
- binding tryptophan: S9 (= S41), A10 (= A42), G12 (= G44), G14 (= G46), Y92 (= Y128), F214 (= F249), T215 (= T250), S217 (= S252), M220 (≠ C255), L312 (= L347)
3gwwA Leucine transporter leut in complex with s-fluoxetine (see paper)
29% identity, 93% coverage: 25:461/469 of query aligns to 1:456/501 of 3gwwA
- binding leucine: A18 (= A42), G20 (= G44), G22 (= G46), Y104 (= Y128), F244 (= F249), T245 (= T250), S247 (= S252), F250 (≠ C255), I350 (≠ L347)
- binding (3S)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (= L45), G22 (= G46), R26 (≠ K50), Y104 (= Y128), A310 (≠ G307), F311 (≠ P308), D392 (= D400), D395 (= D403)
3uslA Crystal structure of leut bound to l-selenomethionine in space group c2 from lipid bicelles (see paper)
29% identity, 93% coverage: 25:461/469 of query aligns to 1:458/502 of 3uslA
- binding selenomethionine: A18 (= A42), G20 (= G44), G22 (= G46), Y104 (= Y128), F246 (= F249), T247 (= T250), S249 (= S252), S348 (= S343), I352 (≠ L347)
- binding sodium ion: G16 (= G40), N17 (≠ S41), A18 (= A42), V19 (= V43), V19 (= V43), G20 (= G44), N23 (= N47), T247 (= T250), N279 (≠ D282), A344 (= A339), T347 (= T342), S348 (= S343)
- binding phosphocholine: N83 (≠ S107), R84 (≠ S108), F85 (≠ R109)
3usgA Crystal structure of leut bound to l-leucine in space group c2 from lipid bicelles (see paper)
29% identity, 93% coverage: 25:461/469 of query aligns to 1:458/502 of 3usgA
- binding leucine: A18 (= A42), G20 (= G44), G22 (= G46), F246 (= F249), T247 (= T250), S249 (= S252), F252 (≠ C255)
- binding sodium ion: G16 (= G40), N17 (≠ S41), A18 (= A42), V19 (= V43), V19 (= V43), G20 (= G44), N23 (= N47), T247 (= T250), N279 (≠ D282), A344 (= A339), T347 (= T342), S348 (= S343)
- binding phosphocholine: N83 (≠ S107), R84 (≠ S108)
2qeiA Crystal structure analysis of leut complexed with l-alanine, sodium, and clomipramine (see paper)
29% identity, 93% coverage: 24:461/469 of query aligns to 1:460/511 of 2qeiA
- binding alanine: A19 (= A42), G21 (= G44), G23 (= G46), Y105 (= Y128), F248 (= F249), T249 (= T250), S251 (= S252)
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (≠ K50), V30 (≠ Y53), Q31 (≠ V54), Y104 (≠ F127), R180 (= R189), R188 (= R194), F189 (≠ S195), F315 (≠ P308), F345 (≠ I338), D396 (= D400), D399 (= D403)
- binding sodium ion: G17 (= G40), A19 (= A42), V20 (= V43), V20 (= V43), G21 (= G44), N24 (= N47), T249 (= T250), N281 (≠ D282), A346 (= A339), T349 (= T342), S350 (= S343)
2q72A Crystal structure analysis of leut complexed with l-leucine, sodium, and imipramine (see paper)
29% identity, 93% coverage: 24:461/469 of query aligns to 1:460/511 of 2q72A
- binding 3-(5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (≠ K50), V30 (≠ Y53), Q31 (≠ V54), R188 (= R194), F189 (≠ S195), I192 (≠ F198), A314 (≠ G307), F315 (≠ P308), F345 (≠ I338), D396 (= D400)
- binding leucine: A19 (= A42), G21 (= G44), L22 (= L45), G23 (= G46), Y105 (= Y128), F248 (= F249), T249 (= T250), S251 (= S252), F254 (≠ C255)
- binding sodium ion: G17 (= G40), A19 (= A42), V20 (= V43), V20 (= V43), G21 (= G44), N24 (= N47), T249 (= T250), N281 (≠ D282), A346 (= A339), T349 (= T342), S350 (= S343)
2q6hA Crystal structure analysis of leut complexed with l-leucine, sodium, and clomipramine (see paper)
29% identity, 93% coverage: 24:461/469 of query aligns to 2:461/512 of 2q6hA
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R28 (≠ K50), Q32 (≠ V54), R189 (= R194), F190 (≠ S195), I193 (≠ F198), F316 (≠ P308), F346 (≠ I338), L396 (≠ F399), D397 (= D400)
- binding leucine: A20 (= A42), G22 (= G44), G24 (= G46), Y106 (= Y128), F249 (= F249), T250 (= T250), S252 (= S252), F255 (≠ C255)
- binding sodium ion: G18 (= G40), A20 (= A42), V21 (= V43), V21 (= V43), G22 (= G44), N25 (= N47), T250 (= T250), N282 (≠ D282), A347 (= A339), T350 (= T342), S351 (= S343)
3f3aA Crystal structure of leut bound to l-tryptophan and sodium (see paper)
29% identity, 93% coverage: 25:461/469 of query aligns to 1:458/504 of 3f3aA
- binding sodium ion: G16 (= G40), N17 (≠ S41), A18 (= A42), V19 (= V43), V19 (= V43), G20 (= G44), N23 (= N47), T247 (= T250), N279 (≠ D282), A344 (= A339), T347 (= T342), S348 (= S343)
- binding tryptophan: R7 (= R31), A18 (= A42), G20 (= G44), L21 (= L45), G22 (= G46), R26 (≠ K50), Y104 (= Y128), G242 (= G245), F246 (= F249), F246 (= F249), T247 (= T250), S249 (= S252), F252 (≠ C255), D265 (≠ G268), Q266 (≠ T269), D267 (≠ S270), F299 (= F294), N303 (≠ F298), A306 (≠ G301), I307 (≠ L302), A310 (≠ G305), N314 (≠ G309), S348 (= S343), I352 (≠ L347), D397 (= D403), G401 (≠ T407), T402 (≠ N408), G432 (≠ A440)
3gwuA Leucine transporter leut in complex with sertraline (see paper)
29% identity, 93% coverage: 25:461/469 of query aligns to 1:459/509 of 3gwuA
- binding leucine: A18 (= A42), G20 (= G44), G22 (= G46), Y104 (= Y128), F247 (= F249), T248 (= T250), S250 (= S252), F253 (≠ C255)
- binding (1S,4S)-4-(3,4-dichlorophenyl)-N-methyl-1,2,3,4-tetrahydronaphthalen-1-amine: L25 (≠ W49), R26 (≠ K50), Y104 (= Y128), F247 (= F249), A313 (≠ G307), D395 (= D400), D398 (= D403)
3f4jA Crystal structure of leut bound to glycine and sodium (see paper)
29% identity, 93% coverage: 25:461/469 of query aligns to 1:459/509 of 3f4jA
- binding glycine: A18 (= A42), G20 (= G44), G22 (= G46), Y104 (= Y128), F247 (= F249), T248 (= T250), S250 (= S252)
- binding sodium ion: G16 (= G40), A18 (= A42), V19 (= V43), V19 (= V43), G20 (= G44), G22 (= G46), N23 (= N47), T248 (= T250), N280 (≠ D282), A345 (= A339), G346 (≠ A340), T348 (= T342), S349 (= S343)
3f3dA Crystal structure of leut bound to l-methionine and sodium (see paper)
29% identity, 93% coverage: 25:461/469 of query aligns to 1:459/509 of 3f3dA
- binding methionine: N17 (≠ S41), A18 (= A42), G20 (= G44), G22 (= G46), Y104 (= Y128), F247 (= F249), T248 (= T250), S250 (= S252), S349 (= S343), I353 (≠ L347)
- binding sodium ion: G16 (= G40), A18 (= A42), V19 (= V43), V19 (= V43), G20 (= G44), N23 (= N47), T248 (= T250), N280 (≠ D282), A345 (= A339), T348 (= T342), S349 (= S343)
3f3cA Crystal structure of leut bound to 4-fluoro-l-phenylalanine and sodium (see paper)
29% identity, 93% coverage: 25:461/469 of query aligns to 1:459/509 of 3f3cA
- binding sodium ion: G16 (= G40), A18 (= A42), V19 (= V43), V19 (= V43), G20 (= G44), N23 (= N47), T248 (= T250), N280 (≠ D282), A345 (= A339), T348 (= T342), S349 (= S343)
- binding 4-fluoro-l-phenylalanine: N17 (≠ S41), A18 (= A42), G20 (= G44), G22 (= G46), Y104 (= Y128), F247 (= F249), T248 (= T250), S250 (= S252), F253 (≠ C255), S349 (= S343), I353 (≠ L347)
3gwvA Leucine transporter leut in complex with r-fluoxetine (see paper)
29% identity, 93% coverage: 25:461/469 of query aligns to 1:459/498 of 3gwvA
- binding leucine: A18 (= A42), G20 (= G44), G22 (= G46), Y104 (= Y128), F247 (= F249), T248 (= T250), S250 (= S252), F253 (≠ C255)
- binding (3R)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (= L45), R26 (≠ K50), A313 (≠ G307), F314 (≠ P308), L394 (≠ F399), D395 (= D400), D398 (= D403)
Query Sequence
>GFF3450 FitnessBrowser__psRCH2:GFF3450
MSDKTSLAAGTFAGARARIQDNASRGLWSSRWVFFLAATGSAVGLGNIWKFPYVTGQNGG
GAFVLVYLACILLIGIPLLMTEVMIGRRGRANPDGAVARLAREAGASSRWRVVGWLGGLT
GFLILSFYLVVAGWALAYVPATFSGGFAGVSGEASGELFGALLADPLRLVVCATLVLAAT
MLIVGFGVRGGLERSLRFLMPGLFVLMLVLVVYAAIEGEFAQALQFLFVPDFSALTAQSV
LIALGHAFFTLSLGCGAMMVYGSYLPEGTSIAKTSILVALADTAVALLAGLAIFPLVFGN
GLEPGAGPGLIFVTLPIAFGQMPLGQVVGGLFFIMLVIAALTSAISLSEPSIAWLTERFR
ISRTKAVLGSGLVLWLLSLGSVFSFNHWADYQLFGKTFFDTLDYLTTNWLMPLGGLGTVL
FTGWVLQRQVVSEAIGIRNAGLFQAWWNLLRYGTPVAIVLVFLNLLGLI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory