SitesBLAST
Comparing GFF3459 FitnessBrowser__psRCH2:GFF3459 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q58761 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
31% identity, 94% coverage: 15:293/298 of query aligns to 13:284/284 of Q58761
1u9zA Crystal structure of phosphoribosyl diphosphate synthase complexed with amp and ribose 5-phosphate (see paper)
32% identity, 94% coverage: 15:293/298 of query aligns to 13:274/274 of 1u9zA
- binding adenosine monophosphate: F32 (= F34), D34 (= D36), E36 (= E38), R92 (= R97), Q93 (= Q98), F97 (= F102), H125 (= H130)
- binding ribose-5-phosphate: D163 (= D172), D202 (= D221), I205 (≠ A224), S206 (= S225), T207 (≠ S226), G208 (= G227), T210 (= T229)
Q97Z86 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
31% identity, 87% coverage: 18:276/298 of query aligns to 16:271/291 of Q97Z86
4twbA Sulfolobus solfataricus ribose-phosphate pyrophosphokinase (see paper)
31% identity, 87% coverage: 18:276/298 of query aligns to 16:258/278 of 4twbA
3mbiA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate (see paper)
25% identity, 95% coverage: 15:296/298 of query aligns to 15:286/287 of 3mbiA
- binding adenosine-5'-diphosphate: F34 (= F34), D36 (= D36), E38 (= E38), R93 (= R97), Q94 (= Q98), Y98 (≠ F102), H126 (= H130), K186 (= K195), R188 (= R197)
- binding magnesium ion: H95 (≠ D99), H126 (= H130)
- binding phosphate ion: R188 (= R197), S216 (= S225), T217 (≠ S226), G218 (= G227), T220 (= T229)
Q97CA5 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) (see paper)
25% identity, 95% coverage: 15:296/298 of query aligns to 13:284/286 of Q97CA5
3lpnA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with an atp analog (ampcpp). (see paper)
25% identity, 95% coverage: 15:296/298 of query aligns to 13:284/284 of 3lpnA
- binding diphosphomethylphosphonic acid adenosyl ester: F32 (= F34), D34 (= D36), E36 (= E38), R91 (= R97), Q92 (= Q98), H93 (≠ D99), Y96 (≠ F102), H124 (= H130), D125 (≠ L131)
- binding sulfate ion: R15 (= R17), S58 (≠ P64), S214 (= S225), T215 (≠ S226), G216 (= G227), T218 (= T229)
Sites not aligning to the query:
3mbiD Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate (see paper)
25% identity, 95% coverage: 15:296/298 of query aligns to 13:284/285 of 3mbiD
- binding adenosine-5'-diphosphate: F32 (= F34), D34 (= D36), E36 (= E38), R91 (= R97), Q92 (= Q98), Y96 (≠ F102), H124 (= H130), K184 (= K195), R186 (= R197)
- binding 5-O-phosphono-alpha-D-ribofuranose: R91 (= R97), H124 (= H130), K184 (= K195), R186 (= R197), D210 (= D221), D211 (= D222), I212 (≠ V223), S214 (= S225), T215 (≠ S226), G216 (= G227), T218 (= T229)
5t3oA Crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus (see paper)
30% identity, 97% coverage: 5:293/298 of query aligns to 2:293/307 of 5t3oA
7pn0A Crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus at r32 space group
30% identity, 97% coverage: 5:293/298 of query aligns to 3:294/312 of 7pn0A
P60891 Ribose-phosphate pyrophosphokinase 1; PPRibP; Phosphoribosyl pyrophosphate synthase I; PRS-I; EC 2.7.6.1 from Homo sapiens (Human) (see 5 papers)
25% identity, 93% coverage: 17:294/298 of query aligns to 18:301/318 of P60891
- D52 (≠ E53) to H: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852542
- N114 (≠ Q115) to S: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852540
- L129 (≠ P129) to I: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852543
- S132 (≠ H132) mutation to A: Reduces catalytic activity.; mutation to F: No effect on catalytic activity.
- V142 (≠ L143) to L: found in a patient with an intermediate phenotype between ARTS and PRPS1 superactivity; likely pathogenic; normal PRPP synthetase activity in fibroblasts; loss of activity in erythrocytes; dbSNP:rs398122855
- N144 (≠ D145) mutation to H: No effect on catalytic activity.
- Y146 (≠ C150) mutation to F: No effect on catalytic activity.; mutation to M: Reduces catalytic activity.
- D183 (≠ A184) to H: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852541
- A190 (≠ G191) to V: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852544
- H193 (≠ S194) to Q: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852545
- D203 (≠ E204) to H: in a breast cancer sample; somatic mutation
- V219 (≠ L220) to G: in a breast cancer sample; somatic mutation
- H231 (≠ Q232) to D: in a colorectal cancer sample; somatic mutation
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 16 S → P: found in patients with phosphoribosyl pyrophosphate synthetase I deficiency; likely pathogenic; dbSNP:rs869025594
8dbkB Human prps1 with phosphate, atp, and r5p; hexamer with resolved catalytic loops (see paper)
25% identity, 93% coverage: 17:294/298 of query aligns to 17:300/316 of 8dbkB
- binding adenosine monophosphate: R95 (= R97), Q96 (= Q98), N199 (≠ H201)
- binding adenosine-5'-triphosphate: F34 (= F34), N36 (≠ D36), E38 (= E38)
- binding phosphate ion: S46 (≠ A50), R48 (vs. gap)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: H129 (= H130), D170 (= D172), G172 (≠ E174), K193 (= K195), R195 (= R197), D219 (= D221), D220 (= D222), D223 (≠ S225), T224 (≠ S226), C225 (≠ G227), G226 (≠ R228), T227 (= T229)
8dbeA Human prps1 with adp; hexamer (see paper)
25% identity, 93% coverage: 17:294/298 of query aligns to 17:300/316 of 8dbeA
- binding adenosine-5'-diphosphate: F34 (= F34), N36 (≠ D36), E38 (= E38), R95 (= R97), Q96 (= Q98), K98 (≠ I100), K99 (≠ A101), D100 (≠ F102), S102 (≠ P104), R103 (≠ G105), H129 (= H130), D142 (≠ E144), Y145 (≠ C150)
- binding 5-O-phosphono-alpha-D-ribofuranose: H129 (= H130), D170 (= D172), D219 (= D221), D220 (= D222), D223 (≠ S225), T224 (≠ S226), G226 (≠ R228), T227 (= T229)
Sites not aligning to the query:
7yk1A Structural basis of human prps2 filaments (see paper)
26% identity, 93% coverage: 17:294/298 of query aligns to 17:291/306 of 7yk1A
- binding adenosine-5'-diphosphate: F34 (= F34), N36 (≠ D36), E38 (= E38), S46 (≠ A50), R48 (vs. gap), R95 (= R97), K99 (≠ A101), D100 (≠ F102), K101 (≠ N103), S102 (≠ P104), R103 (≠ G105), H129 (= H130), D142 (≠ E144)
- binding phosphate ion: D214 (≠ S225), C216 (≠ G227), T218 (= T229)
Sites not aligning to the query:
2hcrA Crystal structure of human phosphoribosyl pyrophosphate synthetase 1 in complex with amp(atp), cadmium and sulfate ion (see paper)
26% identity, 93% coverage: 17:294/298 of query aligns to 16:293/305 of 2hcrA
6nfeA Crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate
27% identity, 84% coverage: 45:294/298 of query aligns to 34:294/298 of 6nfeA
- binding adenosine-5'-diphosphate: F34 (≠ L45), D36 (= D47), E38 (= E49), R95 (= R97), Q96 (= Q98), H130 (= H130)
- binding adenosine monophosphate: R98 (≠ I100), V100 (≠ F102), Y146 (≠ C150), R175 (≠ W178), A178 (= A181), K181 (≠ A184)
- binding 5-O-phosphono-alpha-D-ribofuranose: H130 (= H130), D213 (= D221), D214 (= D222), I215 (≠ V223), D217 (≠ S225), T218 (≠ S226), A219 (≠ G227), T221 (= T229)
6nfeB Crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate
27% identity, 84% coverage: 45:294/298 of query aligns to 34:295/299 of 6nfeB
- binding adenosine-5'-diphosphate: F34 (≠ L45), D36 (= D47), E38 (= E49), R95 (= R97), Q96 (= Q98), H130 (= H130)
- binding 5-O-phosphono-alpha-D-ribofuranose: H130 (= H130), D214 (= D221), D215 (= D222), I216 (≠ V223), D218 (≠ S225), T219 (≠ S226), A220 (≠ G227), T222 (= T229)
8dbgA Human prps1 with phosphate and atp; hexamer (see paper)
25% identity, 93% coverage: 17:294/298 of query aligns to 17:293/309 of 8dbgA
- binding adenosine-5'-triphosphate: F34 (= F34), N36 (≠ D36), E38 (= E38), R95 (= R97), Q96 (= Q98), K98 (≠ I100), H129 (= H130)
- binding phosphate ion: S46 (≠ A50), R48 (vs. gap), D216 (≠ S225), T217 (≠ S226), C218 (≠ G227), T220 (= T229)
O94413 Ribose-phosphate pyrophosphokinase 2; Phosphoribosyl pyrophosphate synthase 2; EC 2.7.6.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 94% coverage: 15:294/298 of query aligns to 18:304/321 of O94413
- S172 (≠ G170) modified: Phosphoserine
P0A717 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Escherichia coli (strain K12) (see 4 papers)
26% identity, 88% coverage: 33:294/298 of query aligns to 34:301/315 of P0A717
- D129 (= D128) to A: in mutant PRSA1; alters the binding of divalent cations, especially magnesium. Little alteration in the affinity for ribose 5-phosphate and 27-fold decrease of the affinity for ATP. Absence of inhibition by AMP
- D220 (= D221) mutation to E: 4-fold decrease in the affinity binding for Rib-5-P in the presence of magnesium ions. In the presence of cobalt ions, it shows a 15-fold decrease in the affinity binding for Rib-5-P.; mutation to F: With magnesium or manganese ions, the affinity binding values for ATP and Rib-5-P are comparable to those of the wild-type.
- D221 (= D222) mutation to A: The affinity binding for ATP is comparable to those of the wild-type, apart from a slight decrease in the presence of manganese ions. The affinity binding for Rib-5-P is greatly decreased in the presence of both manganese and cobalt ions but only about 2-fold in the presence of magnesium ions.
- D224 (≠ S225) mutation to A: With magnesium or manganese ions, the affinity binding values for ATP and Rib-5-P are comparable to those of the wild-type.; mutation to S: With magnesium or manganese ions, the affinity binding values for ATP and Rib-5-P are comparable to those of the wild-type.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>GFF3459 FitnessBrowser__psRCH2:GFF3459
MQSQLLYFDDERAAALRLAEACGLTAAQIERHRFPDDELRLRLPLADGEAIAEQLVIYRG
LDHPNEKLVELLLIAGEARRLGAKRLVLVTPYLAYMRQDIAFNPGEVVSQRVIGQLLAGQ
FDGLITVDPHLHRVATLQEAVPLEDAVTLCAAPALARLIAERHPDALLIGPDAEALQWIE
AAAAEHGFAHGVCSKVRHGDHQVEIALPELQFAGRHVVLLDDVASSGRTLAQAAEKLLAA
GAASVDVAVTHALFAGDALQVIRDAGVGHVWSTDCIAHGSNAVSMAPQLAEALRPLLR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory