Comparing GFF3460 FitnessBrowser__WCS417:GFF3460 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
28% identity, 98% coverage: 1:500/510 of query aligns to 2:484/492 of 3ll3A
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
28% identity, 98% coverage: 1:500/510 of query aligns to 1:482/490 of 3ll3B
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
30% identity, 98% coverage: 5:504/510 of query aligns to 3:483/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
30% identity, 98% coverage: 5:504/510 of query aligns to 3:475/476 of 2itmA
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
28% identity, 90% coverage: 3:461/510 of query aligns to 4:446/478 of 5ya2A
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
28% identity, 90% coverage: 3:461/510 of query aligns to 4:446/478 of 5ya1A
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
24% identity, 92% coverage: 4:470/510 of query aligns to 5:461/495 of 6udeB
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
24% identity, 94% coverage: 2:478/510 of query aligns to 5:472/501 of O34154
Sites not aligning to the query:
3qdkA Structural insight on mechanism and diverse substrate selection strategy of ribulokinase (see paper)
27% identity, 97% coverage: 2:497/510 of query aligns to 1:528/546 of 3qdkA
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
25% identity, 94% coverage: 3:481/510 of query aligns to 4:474/496 of P18157
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
26% identity, 94% coverage: 3:482/510 of query aligns to 4:476/497 of O86033
3h3nX Glycerol kinase h232r with glycerol (see paper)
25% identity, 90% coverage: 2:462/510 of query aligns to 4:456/501 of 3h3nX
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
25% identity, 90% coverage: 2:462/510 of query aligns to 5:457/506 of O34153
1glfO Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
26% identity, 90% coverage: 2:459/510 of query aligns to 3:452/498 of 1glfO
1bo5O Crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate. (see paper)
26% identity, 90% coverage: 2:459/510 of query aligns to 3:452/498 of 1bo5O
P0A6F3 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Escherichia coli (strain K12) (see 10 papers)
26% identity, 90% coverage: 2:459/510 of query aligns to 5:454/502 of P0A6F3
Sites not aligning to the query:
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
24% identity, 99% coverage: 2:508/510 of query aligns to 4:494/499 of 3ge1A
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
24% identity, 99% coverage: 2:508/510 of query aligns to 3:493/498 of Q5HGD2
1bu6Y Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
25% identity, 90% coverage: 2:459/510 of query aligns to 3:452/499 of 1bu6Y
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
26% identity, 90% coverage: 4:462/510 of query aligns to 1:440/485 of 6k76A
>GFF3460 FitnessBrowser__WCS417:GFF3460
MNYVMGVDIGTQSTKALLVDGQGTIIAQHSQGYRVDTPKVRWAEQWPQVWLDAVEACVAQ
CMAKAGVAAEQVKALCISSLYGGSGIAVDAQITPLHPCLIWMDRRAGEQVAWVREQVDLD
RLFAITGNSVDSYYGFTKMLWLKQHQPEVWANTRYLLPPNSYINWCLTGELAVDHSSAGN
IGGVYDVKARDWSGEMLDALGIPQTMMPQRLVYSGEVVGGLLDTWATRLGLQAGTPLLAG
GVDAAMATLAAGVTQPGNHVAMIGTSMCWGYLNQQVDAHHGLVSMPHVYNGHRDLYIFGG
AITAGASVSWFREQFCQAEEQQAKVTGQDSLVLLEQRAMNLPAGSEGLLFLPYLMGERSP
VWDDRASGSFVGLNLYHGRIHLYRAVLEGVSFALRHNIEAGTRGAHSLDPRLIVVGGASH
SDLWMQIIADITQYPVYTIVQEVEAALGAALLAAHSVGLVSDGEMDKGWVQLALRAEPKV
ENVGVYDRAFAEYLKLYPALKPIMHNLQTN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory