SitesBLAST
Comparing GFF3461 FitnessBrowser__WCS417:GFF3461 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q00796 Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 from Homo sapiens (Human) (see 10 papers)
32% identity, 97% coverage: 9:356/359 of query aligns to 11:349/357 of Q00796
- C45 (= C43) binding
- H70 (= H72) binding
- E71 (= E73) binding
- R110 (≠ K115) to P: in SORDD; results in protein aggregation
- H135 (≠ P143) to R: in SORDD; results in protein aggregation
- A153 (= A161) to D: in SORDD; uncertain significance; results in protein aggregation; dbSNP:rs145813597
- I184 (≠ L192) binding
- D204 (= D212) binding
- R209 (= R217) binding
- Q239 (≠ N247) to L: in dbSNP:rs1042079
- N269 (≠ R275) to T: in dbSNP:rs930337
- VG-L 273:275 (≠ FSVF 279:282) binding
- VFR 297:299 (≠ AHL 304:306) binding
- V322 (= V329) to I: in SORDD; uncertain significance; dbSNP:rs149975952
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1pl6A Human sdh/nadh/inhibitor complex (see paper)
32% identity, 97% coverage: 9:356/359 of query aligns to 10:348/356 of 1pl6A
- active site: C44 (= C43), G45 (≠ A44), S46 (= S45), H49 (≠ K48), H69 (= H72), E70 (= E73), R99 (≠ C105), D102 (≠ C108), C105 (= C111), S113 (≠ C119), F117 (= F125), P156 (= P165), G160 (≠ S169), K344 (= K352)
- binding 4-[2-(hydroxymethyl)pyrimidin-4-yl]-n,n-dimethylpiperazine-1-sulfonamide: C44 (= C43), S46 (= S45), I56 (vs. gap), F59 (≠ P62), H69 (= H72), E155 (= E164), L274 (≠ F282), F297 (≠ H305)
- binding nicotinamide-adenine-dinucleotide: G181 (= G190), P182 (≠ T191), I183 (≠ L192), D203 (= D212), L204 (≠ M213), R208 (= R217), C249 (≠ T256), T250 (= T257), V272 (≠ F279), G273 (≠ S280), L274 (≠ F282), F297 (≠ H305), R298 (≠ L306)
- binding zinc ion: C44 (= C43), H69 (= H72)
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
33% identity, 92% coverage: 26:355/359 of query aligns to 23:343/346 of 2dfvA
- active site: C40 (= C43), G41 (≠ A44), T42 (≠ S45), H45 (≠ K48), H65 (= H72), E66 (= E73), C95 (= C105), C98 (= C108), C101 (= C111), C109 (= C119), K113 (≠ N123), P151 (= P165), A155 (≠ S169), K340 (= K352)
- binding nicotinamide-adenine-dinucleotide: G175 (= G190), P176 (≠ T191), L177 (= L192), E197 (≠ D212), P198 (≠ M213), R202 (= R217), F241 (≠ T256), S242 (≠ T257), A244 (≠ V259), L264 (≠ F279), G265 (≠ S280), L266 (≠ V281), I289 (≠ V301), T290 (≠ R302)
- binding zinc ion: C95 (= C105), C101 (= C111), C109 (= C119)
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
33% identity, 92% coverage: 26:355/359 of query aligns to 25:345/348 of O58389
- C42 (= C43) binding
- T44 (≠ S45) mutation to A: Total loss of enzymatic activity.
- H67 (= H72) binding
- E68 (= E73) binding
- C97 (= C105) binding
- C100 (= C108) binding
- C103 (= C111) binding
- C111 (= C119) binding
- E152 (= E164) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (= L192) binding
- E199 (≠ D212) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R217) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ FSV 279:281) binding
- IT 291:292 (≠ VR 301:302) binding
- R294 (≠ A304) mutation to A: 4000-fold decrease in catalytic efficiency.
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
32% identity, 98% coverage: 6:357/359 of query aligns to 4:347/350 of Q5JI69
- L179 (= L192) binding
- E199 (≠ D212) binding
- R204 (= R217) binding
- LGL 266:268 (≠ FSV 279:281) binding
- IT 291:292 (vs. gap) binding
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
32% identity, 98% coverage: 6:357/359 of query aligns to 2:345/347 of 3gfbA
- active site: C40 (= C43), G41 (≠ A44), T42 (≠ S45), H45 (≠ K48), H65 (= H72), E66 (= E73), C95 (= C105), C98 (= C108), C101 (= C111), C109 (= C119), K113 (≠ N123), P151 (= P165), A155 (≠ S169), K340 (= K352)
- binding nicotinamide-adenine-dinucleotide: G173 (= G188), G175 (= G190), P176 (≠ T191), L177 (= L192), S196 (≠ I211), E197 (≠ D212), P198 (≠ M213), R202 (= R217), F241 (≠ T256), S242 (≠ T257), A244 (≠ V259), L264 (≠ F279), G265 (≠ S280), L266 (≠ V281), I289 (vs. gap), T290 (vs. gap)
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
32% identity, 97% coverage: 9:355/359 of query aligns to 4:344/348 of 1e3jA
- active site: C38 (= C43), G39 (≠ A44), S40 (= S45), H43 (≠ K48), H63 (= H72), E64 (= E73), C93 (= C105), C96 (= C108), C99 (= C111), C107 (= C119), T111 (≠ F125), P150 (= P165), G154 (≠ S169), K341 (= K352)
- binding phosphate ion: A174 (= A189), A196 (≠ M213), R197 (≠ V214), S198 (≠ D215), R201 (= R217)
- binding zinc ion: C38 (= C43), H63 (= H72), E64 (= E73), C93 (= C105), C96 (= C108), C99 (= C111), C107 (= C119)
P07846 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Ovis aries (Sheep) (see paper)
31% identity, 98% coverage: 6:356/359 of query aligns to 6:346/354 of P07846
- C43 (= C43) binding
- Y49 (≠ F56) binding
- H67 (= H72) binding
- E68 (= E73) binding
- E153 (= E164) binding
- R296 (≠ L306) binding
- Y297 (≠ G307) binding
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
31% identity, 98% coverage: 6:356/359 of query aligns to 2:343/351 of 3qe3A
- active site: C39 (= C43), G40 (≠ A44), S41 (= S45), H44 (≠ K48), H64 (= H72), E65 (= E73), R94 (≠ C105), D97 (≠ C108), C100 (= C111), S108 (≠ C119), F112 (= F125), P151 (= P165), G155 (≠ S169), K339 (= K352)
- binding glycerol: Y45 (≠ F56), F54 (≠ N61), T116 (≠ R129), R293 (≠ L306)
- binding zinc ion: C39 (= C43), H64 (= H72), E65 (= E73)
P27867 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Rattus norvegicus (Rat) (see paper)
30% identity, 98% coverage: 6:356/359 of query aligns to 8:349/357 of P27867
5kiaA Crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis
31% identity, 94% coverage: 20:355/359 of query aligns to 14:336/339 of 5kiaA
- active site: C37 (= C43), G38 (≠ A44), T39 (≠ S45), H42 (≠ K48), H61 (= H72), E62 (= E73), C91 (= C105), C94 (= C108), C97 (= C111), C105 (= C119), V109 (≠ N123), P147 (= P165), A151 (≠ S169), K333 (= K352)
- binding calcium ion: D146 (≠ E164), N150 (≠ C168), E288 (vs. gap)
- binding zinc ion: C91 (= C105), C94 (= C108), C97 (= C111), C105 (= C119)
4ilkA Crystal structure of short chain alcohol dehydrogenase (rspb) from e. Coli cft073 (efi target efi-506413) complexed with cofactor nadh
30% identity, 95% coverage: 5:344/359 of query aligns to 2:322/337 of 4ilkA
- active site: C40 (= C43), G41 (≠ A44), S42 (= S45), H45 (≠ M55), H59 (= H72), E60 (= E73), C89 (= C105), C92 (= C108), C95 (= C111), C103 (= C119), A107 (≠ N123), P145 (= P165), A149 (≠ S169)
- binding manganese (ii) ion: C40 (= C43), H59 (= H72), E60 (= E73), E144 (= E164)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G168 (= G188), G170 (= G190), P171 (≠ T191), I172 (≠ L192), D193 (= D212), R194 (≠ M213), R198 (= R217), N213 (≠ P232), A235 (≠ T256), A236 (≠ T257), C237 (≠ G258), I241 (≠ G262), M258 (≠ F279), F260 (= F282)
- binding zinc ion: C89 (= C105), C92 (= C108), C95 (= C111), C103 (= C119)
Sites not aligning to the query:
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
30% identity, 92% coverage: 26:356/359 of query aligns to 21:339/341 of P07913
- C38 (= C43) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
28% identity, 99% coverage: 4:357/359 of query aligns to 1:342/342 of 4ejmA
- active site: C40 (= C43), G41 (≠ A44), T42 (≠ S45), H45 (≠ M55), H61 (= H72), E62 (= E73), C91 (= C105), C94 (= C108), C97 (= C111), C105 (= C119), R109 (≠ N123), P147 (= P165), C151 (≠ S169), K337 (= K352)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G188), G172 (= G190), V173 (≠ T191), I174 (≠ L192), T194 (≠ D212), R195 (≠ M213), Q196 (≠ V214), K199 (≠ R217), C240 (≠ T256), E245 (≠ A261), T246 (≠ G262), L263 (≠ F279), V265 (= V281), I291 (≠ L306)
- binding zinc ion: C91 (= C105), C94 (= C108), C97 (= C111), C105 (= C119)
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
28% identity, 99% coverage: 4:357/359 of query aligns to 1:342/343 of 4ej6A
- active site: C40 (= C43), G41 (≠ A44), T42 (≠ S45), H45 (≠ M55), H61 (= H72), E62 (= E73), C91 (= C105), C94 (= C108), C97 (= C111), C105 (= C119), R109 (≠ N123), P147 (= P165), C151 (≠ S169), K337 (= K352)
- binding zinc ion: C91 (= C105), C94 (= C108), C97 (= C111), C105 (= C119)
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
29% identity, 98% coverage: 5:355/359 of query aligns to 1:354/357 of 7y9pA
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
27% identity, 90% coverage: 26:349/359 of query aligns to 22:335/347 of 5vm2A
- active site: C39 (= C43), G40 (≠ A44), S41 (= S45), H44 (≠ K48), H65 (= H72), E66 (= E73), C95 (= C105), C98 (= C108), C101 (= C111), C109 (= C119), D113 (≠ N123), P153 (= P165), G157 (≠ S169)
- binding magnesium ion: H65 (= H72), E66 (= E73), E152 (= E164)
- binding zinc ion: C95 (= C105), C98 (= C108), C101 (= C111), C109 (= C119)
Sites not aligning to the query:
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
27% identity, 97% coverage: 7:355/359 of query aligns to 1:343/346 of 4cpdA
- active site: C38 (= C43), G39 (≠ A44), S40 (= S45), H43 (≠ K48), H59 (= H72), E60 (= E73), C89 (= C105), C92 (= C108), C95 (= C111), C103 (= C119), G107 (≠ N123), D152 (≠ E164), T156 (≠ C168), K340 (= K352)
- binding nicotinamide-adenine-dinucleotide: G39 (≠ A44), S40 (= S45), T156 (≠ C168), G178 (= G190), P179 (≠ T191), V180 (≠ L192), D200 (= D212), R201 (≠ M213), R205 (= R217), A243 (≠ T256), V244 (≠ T257), V266 (≠ F279), V268 (= V281), L292 (≠ H305), A293 (≠ L306), F333 (≠ A345)
- binding zinc ion: C38 (= C43), H59 (= H72), C89 (= C105), C92 (= C108), C95 (= C111), C103 (= C119), D152 (≠ E164)
5ylnA Zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form
30% identity, 94% coverage: 7:344/359 of query aligns to 5:328/348 of 5ylnA
4oh1A Crystal structure of a putative zinc-binding dehydrogenase (gutb) from clostridium scindens atcc 35704 at 2.00 a resolution
28% identity, 92% coverage: 26:356/359 of query aligns to 29:348/351 of 4oh1A
- active site: C46 (= C43), G47 (≠ A44), S48 (= S45), H51 (≠ K48), H74 (= H72), E75 (= E73), C106 (= C105), C109 (= C108), C112 (= C111), C120 (= C119), P158 (= P165), A162 (≠ S169), K344 (= K352)
- binding zinc ion: C46 (= C43), H74 (= H72), E75 (= E73), C106 (= C105), C109 (= C108), C112 (= C111), C120 (= C119), E157 (= E164)
Query Sequence
>GFF3461 FitnessBrowser__WCS417:GFF3461
MDKHTEMQAVVCHGPKDYRLERIGKPQARANELVIRIAACGICASDCKCHSGAAMFWGGD
NPWVKAPVVPGHEFFGYVVEAGEGAEEHFEVAVGDKVIAEQIVPCGKCRFCKSGKYWMCE
VHNIFGFQREVAEGGMAQYMRIPKTAIVHKIPESVSLEDSALVEPMACSIHTVNRGDIQL
DDVVVIAGAGTLGLCMVQVAALKTPKKLVVIDMVDERLELAKKFGADVVINPSRDNAREI
INGLTDNYGCDVYIETTGVPAGVTQGLDLIRKLGRFVEFSVFGAETSVDWSIIGDRKELD
VRGAHLGPYCYPIAIDLFERGLVTSKGIVTHDFPLDDWAEAFELANSTKSIKVLLKPVV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory