Comparing GFF3463 FitnessBrowser__WCS417:GFF3463 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
43% identity, 94% coverage: 1:473/502 of query aligns to 1:471/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 43% coverage: 4:220/502 of query aligns to 2:214/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 43% coverage: 4:217/502 of query aligns to 1:212/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 43% coverage: 4:220/502 of query aligns to 3:216/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 43% coverage: 4:220/502 of query aligns to 3:216/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 43% coverage: 4:220/502 of query aligns to 3:216/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 43% coverage: 4:220/502 of query aligns to 3:216/242 of 2oljA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 43% coverage: 4:217/502 of query aligns to 1:217/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 43% coverage: 4:217/502 of query aligns to 2:218/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 43% coverage: 4:217/502 of query aligns to 2:218/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
31% identity, 43% coverage: 4:217/502 of query aligns to 2:218/344 of 6cvlD
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
33% identity, 44% coverage: 2:221/502 of query aligns to 1:218/223 of 2pclA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
35% identity, 43% coverage: 1:217/502 of query aligns to 1:219/648 of P75831
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
32% identity, 41% coverage: 12:217/502 of query aligns to 10:218/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
32% identity, 41% coverage: 13:217/502 of query aligns to 11:218/592 of 5lj7A
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 46% coverage: 7:239/502 of query aligns to 6:242/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 46% coverage: 7:239/502 of query aligns to 6:242/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 46% coverage: 7:239/502 of query aligns to 6:242/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
32% identity, 46% coverage: 7:239/502 of query aligns to 6:242/353 of Q97UY8
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 43% coverage: 1:217/502 of query aligns to 14:224/378 of P69874
Sites not aligning to the query:
>GFF3463 FitnessBrowser__WCS417:GFF3463
MSSLLKLENICKRYPGVQALKSINLQVERGEIHALLGENGAGKSTLMKILGGVEHQDEGQ
ILIDGQAQQFATYRDAIAAGIGIVFQEFSLIPYLTAVENIFLGHELSNRFGLLRKREMVE
ASEALFKRLGVTIDLQCAVKHLSVAEQQFVEIAKALALDARLLVLDEPTATLTPSEAELL
FEIMRELKRQGVAVIFISHHLEEIFQVCDRISVLRDGGNVGVTDVADSDIDHLVEMMVGR
RLACSFPPKPTRERGPLLLEVKDIQLVRNGPHNRFQLHKGEILGFAGLVGSGRTELALGM
MGALPSVSKDVWLRGEKITLDDPAQALAHGIGLLPESRKSEGLITDFSIRENISLNNLPK
YQNASGLIDKNRECASVEGLMKQLSIKAPSSESRVFNLSGGNQQKVVIARWINHHCDVLV
FDEPTRGIDVGAKAQIYALMRSLTEQGYAIIMISSELPEIIGMCDRVAVFHKGAIVKLLE
ASAVNPQEVMRHATGGSSEYVH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory