Comparing GFF3483 FitnessBrowser__WCS417:GFF3483 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1gttA Crystal structure of hpce (see paper)
66% identity, 87% coverage: 25:246/256 of query aligns to 204:417/421 of 1gttA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
40% identity, 80% coverage: 39:243/256 of query aligns to 87:300/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
40% identity, 80% coverage: 39:243/256 of query aligns to 88:301/303 of 8sutA
Q8R0F8 Oxaloacetate decarboxylase, mitochondrial; OAA decarboxylase; ODx; Acylpyruvase FAHD1; Acylpyruvate hydrolase; ApH; Fumarylacetoacetate hydrolase domain-containing protein 1; EC 4.1.1.112; EC 3.7.1.5 from Mus musculus (Mouse) (see paper)
38% identity, 75% coverage: 45:236/256 of query aligns to 16:209/221 of Q8R0F8
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
38% identity, 75% coverage: 45:236/256 of query aligns to 13:206/216 of 6sbiA
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
38% identity, 78% coverage: 45:243/256 of query aligns to 14:214/218 of 6fogA
Sites not aligning to the query:
Q6P587 Oxaloacetate decarboxylase, mitochondrial; OAA decarboxylase; ODx; Acylpyruvase FAHD1; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; YisK-like protein; EC 4.1.1.112; EC 3.7.1.5 from Homo sapiens (Human) (see 4 papers)
38% identity, 78% coverage: 45:243/256 of query aligns to 16:216/221 of Q6P587
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
37% identity, 87% coverage: 25:247/256 of query aligns to 50:251/252 of 3qdfA
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
39% identity, 71% coverage: 42:222/256 of query aligns to 69:249/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
39% identity, 71% coverage: 42:222/256 of query aligns to 69:249/290 of 8gsrA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
37% identity, 80% coverage: 41:245/256 of query aligns to 67:277/279 of 6v77B
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
36% identity, 89% coverage: 15:243/256 of query aligns to 45:274/277 of 6iymA
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
33% identity, 93% coverage: 8:245/256 of query aligns to 45:262/264 of 6jvwB
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
36% identity, 86% coverage: 25:244/256 of query aligns to 50:267/269 of 4dbhA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
31% identity, 96% coverage: 1:246/256 of query aligns to 1:279/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
31% identity, 96% coverage: 1:246/256 of query aligns to 1:279/280 of 6j5xA
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
32% identity, 79% coverage: 45:246/256 of query aligns to 25:233/233 of 6j5yA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
33% identity, 70% coverage: 41:219/256 of query aligns to 60:229/265 of 3r6oA
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
31% identity, 74% coverage: 44:233/256 of query aligns to 16:209/224 of 3v77A
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
27% identity, 75% coverage: 42:233/256 of query aligns to 7:222/247 of 1nkqA
>GFF3483 FitnessBrowser__WCS417:GFF3483
MKRARIRFENEIHAVQVEADNAVRLDDGRLLAEDQVEWLPPATGNMFALGLNYADHAAEL
AFTPPTEPLAFIKSVGTYTGHRHVTWRPDNVAYMHYECELVAVIGKAARNVKRADALDYL
AGYTVCNDYAIRDYLENYYRPNLRVKNRDATTPVGPWIVDVADVPDPGNLTLRTWINGEL
RQEGSTRDMIFDIPYLIEYLSSFMTLQPGDMIATGTPEGLADVVPGDEVVVEVEGVGRLV
NRIVSEADFFSARKEA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory