SitesBLAST – Find functional sites

 

SitesBLAST

Comparing GFF3483 FitnessBrowser__WCS417:GFF3483 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 19 hits to proteins with known functional sites (download)

1gttA Crystal structure of hpce (see paper)
66% identity, 87% coverage: 25:246/256 of query aligns to 204:417/421 of 1gttA

query
sites
1gttA
L
 
V
D
 
D
D
 
E
G
 
R
R
 
E
L
 
V
L
 
T
A
 
T
E
 
R
D
 
K
Q
 
S
V
 
F
E
 
P
W
 
T
L
 
L
P
 
P
P
 
H
A
 
P
T
 
H
G
 
G
N
 
T
M
 
L
F
 
F
A
 
A
L
 
L
G
 
G
L
 
L
N
 
N
Y
 
Y
A
 
A
D
 
D
H
 
H
A
 
-
A
 
-
E
 
-
L
 
-
A
 
-
F
 
-
T
 
-
P
 
-
P
 
P
T
 
E
E
 
E
P
 
P
L
 
L
A
 
V
F
 
F
I
 
L
K
 
K
S
 
A
V
 
P
G
 
N
T
 
T
Y
 
L
T
 
T
G
 
G
H
 
D
R
 
N
H
 
Q
V
 
T
T
 
S
W
 
V
R
 
R
P
 
P
D
 
N
N
 
N
V
 
I
A
 
E
Y
 
Y
M
 
M
H
 
H
Y
 
Y
E
|
E
C
 
A
E
|
E
L
 
L
V
 
V
A
 
V
V
 
V
I
 
I
G
 
G
K
 
K
A
 
Q
A
 
A
R
 
R
N
 
N
V
 
V
K
 
S
R
 
E
A
 
A
D
 
D
A
 
A
L
 
M
D
 
D
Y
 
Y
L
 
V
A
 
A
G
 
G
Y
 
Y
T
 
T
V
 
V
C
 
C
N
 
N
D
|
D
Y
 
Y
A
 
A
I
 
I
R
 
R
D
 
D
Y
 
Y
L
 
L
E
 
E
N
 
N
Y
 
Y
Y
 
Y
R
 
R
P
 
P
N
 
N
L
 
L
R
 
R
V
 
V
K
 
K
N
 
S
R
 
R
D
 
D
A
 
G
T
 
L
T
 
T
P
 
P
V
 
M
G
 
L
P
 
S
W
 
T
I
 
I
V
 
V
D
 
P
V
 
K
A
 
E
D
 
A
V
 
I
P
 
P
D
 
D
P
 
P
G
 
H
N
 
N
L
 
L
T
 
T
L
 
L
R
 
R
T
 
T
W
 
F
I
 
V
N
 
N
G
 
G
E
 
E
L
 
L
R
 
R
Q
 
Q
E
 
Q
G
 
G
S
 
T
T
 
T
R
 
A
D
 
D
M
 
L
I
 
I
F
 
F
D
 
S
I
 
V
P
 
P
Y
 
F
L
 
L
I
 
I
E
 
A
Y
 
Y
L
 
L
S
 
S
S
 
E
F
 
F
M
 
M
T
 
T
L
 
L
Q
 
N
P
 
P
G
 
G
D
 
D
M
 
M
I
 
I
A
 
A
T
 
T
G
 
G
T
 
T
P
 
P
E
 
K
G
 
G
L
 
L
A
 
S
D
 
D
V
 
V
V
 
V
P
 
P
G
 
G
D
 
D
E
 
E
V
 
V
V
 
V
V
 
V
E
 
E
V
 
V
E
 
E
G
 
G
V
 
V
G
 
G
R
 
R
L
 
L
V
 
V
N
 
N
R
 
R
I
 
I
V
 
V
S
 
S
E
 
E

8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
40% identity, 80% coverage: 39:243/256 of query aligns to 87:300/303 of 8skyB

query
sites
8skyB
L
 
I
P
 
P
P
 
K
A
 
P
T
 
S
G
 
K
N
 
N
M
 
I
F
 
I
A
 
C
L
x
I
G
|
G
L
 
K
N
 
N
Y
 
Y
A
 
R
D
 
D
H
|
H
A
 
A
A
 
I
E
 
E
L
 
M
A
 
G
F
 
S
T
 
E
P
 
A
-
 
D
-
 
I
P
 
P
T
 
E
E
 
H
P
 
P
L
 
M
A
 
V
F
 
F
I
 
T
K
 
K
S
 
S
V
 
P
G
 
V
T
 
T
Y
 
V
T
 
T
G
 
G
H
 
H
R
 
G
H
 
D
V
 
I
T
 
V
W
 
K
R
 
S
P
 
H
D
 
E
N
 
E
V
 
V
-
 
T
A
 
S
Y
 
Q
M
 
L
H
 
D
Y
 
Y
E
|
E
C
 
G
E
|
E
L
 
L
V
 
A
A
 
V
V
 
V
I
 
I
G
 
G
K
 
K
A
 
S
A
 
G
R
 
T
N
 
R
V
 
I
K
 
S
R
 
K
A
 
E
D
 
D
A
 
A
L
 
Y
D
 
D
Y
 
H
L
 
V
A
 
F
G
 
G
Y
 
Y
T
 
T
V
 
I
C
 
V
N
 
N
D
|
D
Y
 
I
A
 
T
I
 
A
R
 
R
D
 
D
Y
 
-
L
 
L
E
 
Q
N
 
K
Y
 
R
Y
 
H
R
 
K
P
 
Q
N
 
F
L
 
F
R
 
I
V
 
G
K
|
K
N
 
S
R
 
L
D
 
D
A
 
T
T
 
T
T
 
C
P
 
P
V
 
M
G
 
G
P
 
P
W
 
V
I
 
L
V
 
V
D
 
H
V
 
K
A
 
S
D
 
S
V
 
I
P
 
Q
D
 
E
P
 
P
G
 
E
N
 
R
L
 
L
T
 
K
L
 
V
R
 
E
T
 
T
W
 
R
I
 
V
N
 
N
G
 
G
E
 
E
L
 
L
R
 
R
Q
 
Q
E
 
S
G
 
G
S
 
S
T
 
A
R
 
S
D
 
D
M
 
M
I
 
I
F
 
F
D
 
S
I
 
I
P
 
P
Y
 
E
L
 
L
I
 
I
E
 
E
Y
 
T
L
 
L
S
 
S
S
 
K
F
 
G
M
 
M
T
 
T
L
 
L
Q
 
E
P
 
A
G
 
G
D
 
D
M
 
I
I
 
I
A
 
A
T
 
T
G
|
G
T
|
T
P
 
P
E
 
S
G
 
G
L
 
V
A
 
G
D
 
K
-
 
G
-
 
F
-
 
T
-
 
P
-
 
P
-
 
K
-
 
F
V
 
L
V
 
R
P
 
S
G
 
G
D
 
D
E
 
K
V
 
I
V
 
D
V
 
I
E
 
T
V
 
I
E
 
D
G
 
P
V
 
I
G
 
G
R
 
T
L
 
L
V
 
S
N
 
N
R
 
Q
I
 
I

8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
40% identity, 80% coverage: 39:243/256 of query aligns to 88:301/303 of 8sutA

query
sites
8sutA
L
 
I
P
 
P
P
 
K
A
 
P
T
 
S
G
 
K
N
 
N
M
 
I
F
 
I
A
 
C
L
x
I
G
|
G
L
x
K
N
 
N
Y
 
Y
A
 
R
D
 
D
H
|
H
A
 
A
A
 
I
E
 
E
L
 
M
A
 
G
F
 
S
T
 
E
P
 
A
-
 
D
-
 
I
P
 
P
T
 
E
E
 
H
P
 
P
L
 
M
A
 
V
F
|
F
I
 
T
K
 
K
S
 
S
V
 
P
G
 
V
T
 
T
Y
 
V
T
 
T
G
 
G
H
 
H
R
 
G
H
 
D
V
 
I
T
 
V
W
 
K
R
 
S
P
 
H
D
 
E
N
 
E
V
 
V
-
 
T
A
 
S
Y
 
Q
M
 
L
H
 
D
Y
 
Y
E
|
E
C
 
G
E
|
E
L
 
L
V
 
A
A
 
V
V
 
V
I
 
I
G
 
G
K
 
K
A
 
S
A
 
G
R
 
T
N
 
R
V
 
I
K
 
S
R
 
K
A
 
E
D
 
D
A
 
A
L
 
Y
D
 
D
Y
 
H
L
 
V
A
 
F
G
 
G
Y
 
Y
T
 
T
V
 
I
C
 
V
N
 
N
D
|
D
Y
 
I
A
 
T
I
 
A
R
|
R
D
 
D
Y
 
-
L
 
L
E
x
Q
N
 
K
Y
 
R
Y
 
H
R
 
K
P
 
Q
N
 
F
L
 
F
R
 
I
V
 
G
K
|
K
N
 
S
R
 
L
D
 
D
A
 
T
T
 
T
T
 
C
P
 
P
V
 
M
G
 
G
P
 
P
W
 
V
I
 
L
V
 
V
D
 
H
V
 
K
A
 
S
D
 
S
V
 
I
P
 
Q
D
 
E
P
 
P
G
 
E
N
 
R
L
 
L
T
 
K
L
 
V
R
 
E
T
 
T
W
 
R
I
 
V
N
 
N
G
 
G
E
 
E
L
 
L
R
 
R
Q
 
Q
E
 
S
G
 
G
S
 
S
T
 
A
R
 
S
D
 
D
M
 
M
I
 
I
F
 
F
D
 
S
I
 
I
P
 
P
Y
 
E
L
 
L
I
 
I
E
 
E
Y
 
T
L
 
L
S
 
S
S
 
K
F
 
G
M
 
M
T
 
T
L
 
L
Q
 
E
P
 
A
G
 
G
D
 
D
M
 
I
I
 
I
A
 
A
T
 
T
G
|
G
T
|
T
P
 
P
E
 
S
G
 
G
L
 
V
A
 
G
D
 
K
-
 
G
-
 
F
-
 
T
-
 
P
-
 
P
-
 
K
-
 
F
V
 
L
V
 
R
P
 
S
G
 
G
D
 
D
E
 
K
V
 
I
V
 
D
V
 
I
E
 
T
V
 
I
E
 
D
G
 
P
V
 
I
G
 
G
R
 
T
L
 
L
V
 
S
N
 
N
R
 
Q
I
 
I

6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
38% identity, 75% coverage: 45:236/256 of query aligns to 13:206/216 of 6sbiA

query
sites
6sbiA
N
 
N
M
 
I
F
 
V
A
 
C
L
 
V
G
|
G
L
x
R
N
 
N
Y
 
Y
A
 
A
D
 
D
H
|
H
A
 
V
A
 
K
E
 
E
L
 
M
A
 
R
F
 
S
T
 
T
P
 
V
P
 
L
T
 
S
E
 
E
P
 
P
L
 
V
A
 
L
F
 
F
I
 
L
K
 
K
S
 
P
V
x
S
G
 
T
T
 
A
Y
 
Y
T
 
A
G
 
P
H
 
E
R
 
G
H
 
S
V
 
P
T
 
V
W
 
L
R
 
M
P
 
P
D
 
A
N
 
Y
V
 
C
A
 
R
Y
 
N
M
 
L
H
 
H
Y
 
H
E
|
E
C
 
V
E
|
E
L
 
L
V
 
G
A
 
V
V
 
L
I
 
L
G
 
G
K
 
K
A
 
R
A
 
G
R
 
E
N
 
A
V
 
I
K
 
P
R
 
E
A
 
A
D
 
A
A
 
A
L
 
M
D
 
D
Y
 
Y
L
 
V
A
 
A
G
 
G
Y
 
Y
T
 
A
V
 
L
C
 
C
N
 
L
D
|
D
Y
 
M
A
 
T
I
 
A
R
 
R
D
 
D
Y
 
V
L
 
Q
E
 
E
N
 
E
Y
 
C
Y
 
K
R
 
K
P
 
K
N
 
G
L
 
L
-
 
P
-
 
W
-
 
T
R
 
L
V
 
A
K
|
K
N
 
S
R
 
F
D
 
T
A
 
S
T
 
S
T
 
C
P
 
P
V
 
V
G
 
S
P
 
A
W
 
F
I
 
-
V
 
V
D
 
P
V
 
K
A
 
E
D
 
K
V
 
I
P
 
P
D
 
D
P
 
P
G
 
H
N
 
A
L
 
L
T
 
R
L
 
L
R
 
W
T
 
L
W
 
K
I
 
V
N
 
N
G
 
G
E
 
E
L
 
L
R
 
R
Q
 
Q
E
 
E
G
 
G
S
 
K
T
 
T
R
 
S
D
 
S
M
 
M
I
 
I
F
 
F
D
 
S
I
 
I
P
 
P
Y
 
Y
L
 
I
I
 
I
E
 
S
Y
 
Y
L
 
V
S
 
S
S
 
K
F
 
I
M
 
I
T
|
T
L
 
L
Q
 
E
P
 
E
G
 
G
D
 
D
M
 
L
I
 
I
A
 
L
T
 
T
G
 
G
T
 
T
P
 
P
E
 
K
G
 
G
L
x
V
A
 
G
D
 
P
V
 
I
V
 
K
P
 
E
G
 
N
D
 
D
E
 
E
V
 
I
V
 
E
V
 
A
E
 
G
V
 
I
E
 
D
G
 
G
V
 
V

6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
38% identity, 78% coverage: 45:243/256 of query aligns to 14:214/218 of 6fogA

query
sites
6fogA
N
|
N
M
 
I
F
 
V
A
 
C
L
 
V
G
|
G
L
 
R
N
 
N
Y
 
Y
A
 
A
D
 
D
H
 
H
A
 
V
A
 
R
E
 
E
L
 
M
A
 
R
F
 
S
T
 
A
P
 
V
P
 
L
T
 
S
E
 
E
P
 
P
L
 
V
A
 
L
F
 
F
I
 
L
K
 
K
S
 
P
V
 
S
G
 
T
T
 
A
Y
 
Y
T
 
A
G
 
P
H
 
E
R
 
G
H
 
S
V
 
P
T
 
I
W
 
L
R
 
M
P
 
P
D
 
A
N
 
Y
V
 
T
A
 
R
Y
 
N
M
 
L
H
 
H
Y
 
H
E
|
E
C
 
L
E
|
E
L
 
L
V
 
G
A
 
V
V
 
V
I
 
M
G
 
G
K
 
K
A
 
R
A
 
C
R
 
R
N
 
A
V
 
V
K
 
P
R
 
E
A
 
A
D
 
A
A
 
A
L
 
M
D
 
D
Y
 
Y
L
 
V
A
 
G
G
 
G
Y
 
Y
T
 
A
V
 
L
C
 
C
N
 
L
D
|
D
Y
 
M
A
 
T
I
 
A
R
 
R
D
 
D
Y
 
V
L
 
Q
E
 
D
N
 
E
Y
 
C
Y
 
K
R
 
K
P
 
K
N
 
G
L
 
L
-
 
P
-
 
W
-
 
T
R
 
L
V
 
A
K
 
K
N
 
S
R
 
F
D
 
T
A
 
A
T
 
S
T
 
C
P
 
P
V
 
V
G
 
S
P
 
A
W
 
F
I
 
-
V
 
V
D
 
P
V
 
K
A
 
E
D
 
K
V
 
I
P
 
P
D
 
D
P
 
P
G
 
H
N
 
K
L
 
L
T
 
K
L
 
L
R
 
W
T
 
L
W
 
K
I
 
V
N
 
N
G
 
G
E
 
E
L
 
L
R
 
R
Q
 
Q
E
 
E
G
 
G
S
 
E
T
 
T
R
 
S
D
 
S
M
 
M
I
 
I
F
 
F
D
 
S
I
 
I
P
 
P
Y
 
Y
L
 
I
I
 
I
E
 
S
Y
 
Y
L
 
V
S
 
S
S
 
K
F
 
I
M
 
I
T
 
T
L
 
L
Q
 
E
P
 
E
G
 
G
D
 
D
M
 
I
I
 
I
A
 
L
T
 
T
G
 
G
T
|
T
P
 
P
E
 
K
G
 
G
L
 
V
A
 
G
D
 
P
V
 
V
V
 
K
P
 
E
G
 
N
D
 
D
E
 
E
V
 
I
V
 
E
V
 
A
E
 
G
V
 
I
E
 
H
G
 
G
V
 
L
G
 
V
R
 
S
L
 
M
V
 
T
N
 
F
R
 
K
I
 
V

Sites not aligning to the query:

Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
38% identity, 78% coverage: 45:243/256 of query aligns to 16:216/221 of Q6P587

query
sites
Q6P587
N
 
N
M
 
I
F
 
V
A
 
C
L
 
V
G
 
G
L
 
R
N
 
N
Y
 
Y
A
 
A
D
 
D
H
|
H
A
 
V
A
 
R
E
|
E
L
 
M
A
 
R
F
 
S
T
 
A
P
 
V
P
 
L
T
 
S
E
 
E
P
 
P
L
 
V
A
 
L
F
 
F
I
 
L
K
 
K
S
 
P
V
 
S
G
 
T
T
 
A
Y
 
Y
T
 
A
G
 
P
H
 
E
R
 
G
H
 
S
V
 
P
T
 
I
W
 
L
R
 
M
P
 
P
D
 
A
N
 
Y
V
 
T
A
 
R
Y
 
N
M
 
L
H
 
H
Y
 
H
E
|
E
C
 
L
E
|
E
L
 
L
V
 
G
A
 
V
V
 
V
I
 
M
G
 
G
K
 
K
A
 
R
A
 
C
R
 
R
N
 
A
V
 
V
K
 
P
R
 
E
A
 
A
D
 
A
A
 
A
L
 
M
D
 
D
Y
 
Y
L
 
V
A
 
G
G
 
G
Y
 
Y
T
 
A
V
 
L
C
 
C
N
 
L
D
|
D
Y
 
M
A
 
T
I
 
A
R
|
R
D
 
D
Y
 
V
L
 
Q
E
 
D
N
 
E
Y
 
C
Y
 
K
R
 
K
P
 
K
N
 
G
L
 
L
-
 
P
-
 
W
-
 
T
R
 
L
V
 
A
K
 
K
N
 
S
R
 
F
D
 
T
A
 
A
T
 
S
T
 
C
P
 
P
V
 
V
G
 
S
P
 
A
W
 
F
I
 
-
V
 
V
D
 
P
V
 
K
A
 
E
D
 
K
V
 
I
P
 
P
D
 
D
P
 
P
G
 
H
N
 
K
L
 
L
T
 
K
L
 
L
R
 
W
T
 
L
W
 
K
I
 
V
N
 
N
G
 
G
E
 
E
L
 
L
R
 
R
Q
 
Q
E
 
E
G
 
G
S
 
E
T
 
T
R
 
S
D
 
S
M
 
M
I
 
I
F
 
F
D
 
S
I
 
I
P
 
P
Y
 
Y
L
 
I
I
 
I
E
 
S
Y
 
Y
L
 
V
S
 
S
S
 
K
F
 
I
M
 
I
T
 
T
L
 
L
Q
 
E
P
 
E
G
 
G
D
 
D
M
 
I
I
 
I
A
 
L
T
 
T
G
 
G
T
 
T
P
 
P
E
 
K
G
 
G
L
 
V
A
 
G
D
 
P
V
 
V
V
 
K
P
 
E
G
 
N
D
 
D
E
 
E
V
 
I
V
 
E
V
 
A
E
 
G
V
 
I
E
 
H
G
 
G
V
 
L
G
 
V
R
 
S
L
 
M
V
 
T
N
 
F
R
 
K
I
 
V

3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
37% identity, 87% coverage: 25:247/256 of query aligns to 50:251/252 of 3qdfA

query
sites
3qdfA
L
 
L
D
 
A
D
 
D
G
 
V
R
 
R
L
 
L
L
 
L
A
 
A
E
 
-
D
 
-
Q
 
-
V
 
-
E
 
-
W
 
-
L
 
-
P
 
P
P
 
I
A
 
L
T
 
A
G
 
S
N
 
K
M
 
V
F
 
V
A
 
C
L
 
V
G
 
G
L
 
K
N
 
N
Y
 
Y
A
 
T
D
 
-
H
 
-
A
 
-
A
 
-
E
 
-
L
 
-
A
 
-
F
 
-
T
 
-
P
 
-
P
 
P
T
 
A
E
 
D
P
 
P
L
 
V
A
 
I
F
 
F
I
 
L
K
 
K
S
 
P
V
 
N
G
 
T
T
 
A
Y
 
I
T
 
V
G
 
G
H
 
P
R
 
N
H
 
V
V
 
P
T
 
I
W
 
R
R
 
L
P
 
P
D
 
A
N
 
N
V
 
A
A
 
S
Y
 
P
M
 
V
H
 
H
Y
 
F
E
|
E
C
 
G
E
|
E
L
 
L
V
 
A
A
 
I
V
 
V
I
 
I
G
 
G
K
 
R
A
 
P
A
 
C
R
 
K
N
 
D
V
 
V
K
 
S
R
 
A
A
 
A
D
 
Q
A
 
A
L
 
V
D
 
D
Y
 
N
L
 
I
A
 
L
G
 
G
Y
 
Y
T
 
T
V
 
I
C
 
G
N
 
N
D
|
D
Y
 
V
A
 
S
I
 
A
R
 
R
D
 
D
Y
 
Q
L
 
Q
E
 
K
N
 
S
Y
 
D
Y
 
G
R
 
Q
P
 
-
N
 
W
L
 
T
R
 
R
V
 
A
K
 
K
N
 
G
R
 
H
D
 
D
A
 
T
T
 
F
T
 
C
P
 
P
V
 
V
G
 
G
P
 
P
W
 
W
I
 
I
V
 
V
D
 
-
V
 
-
A
 
T
D
 
D
V
 
V
P
 
-
D
 
D
P
 
P
G
 
A
N
 
D
L
 
L
T
x
E
L
 
L
R
 
R
T
 
T
W
 
E
I
 
V
N
 
N
G
 
G
E
 
A
L
 
V
R
 
K
Q
 
Q
E
x
H
G
 
A
S
 
R
T
 
T
R
 
S
D
 
L
M
 
M
I
 
I
F
 
H
D
 
D
I
 
V
P
 
G
Y
 
A
L
 
I
I
 
V
E
 
E
Y
 
W
L
 
I
S
 
S
S
 
A
F
 
V
M
 
M
T
 
T
L
 
L
Q
 
L
P
 
P
G
 
G
D
 
D
M
 
L
I
 
I
A
 
L
T
 
T
G
 
G
T
 
T
P
 
P
E
 
A
G
 
G
L
 
V
A
 
G
D
 
P
V
 
I
V
 
E
P
 
D
G
 
G
D
 
D
E
 
T
V
 
V
V
 
S
V
 
I
E
 
T
V
 
I
E
 
E
G
 
G
V
 
I
G
 
G
R
 
T
L
 
L
V
 
T
N
 
N
R
 
P
I
 
V
V
 
V
S
 
R
E
 
K
A
 
G

8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
39% identity, 71% coverage: 42:222/256 of query aligns to 69:249/290 of 8gstC

query
sites
8gstC
A
 
G
T
 
I
G
 
G
N
 
K
M
 
I
F
 
V
A
 
A
L
x
I
G
|
G
L
 
L
N
 
N
Y
 
Y
A
 
E
D
 
D
H
|
H
A
 
A
A
 
I
E
 
E
L
 
S
A
 
N
F
 
L
T
 
P
P
 
I
P
 
P
T
 
T
E
 
E
P
 
P
L
 
M
A
 
M
F
 
F
I
 
M
K
 
K
S
 
A
V
 
L
G
 
S
T
 
S
Y
 
L
T
 
N
G
 
G
H
 
P
R
 
N
H
 
D
V
 
E
T
 
V
W
 
V
R
 
L
P
 
P
D
 
K
N
 
N
V
 
S
A
 
T
Y
 
H
M
 
G
H
 
D
Y
 
W
E
|
E
C
 
V
E
|
E
L
 
L
V
 
G
A
 
V
V
 
V
I
 
I
G
 
G
K
 
E
A
 
T
A
 
C
R
 
R
N
 
F
V
 
V
K
 
S
R
 
E
A
 
D
D
 
E
A
 
A
L
 
L
D
 
S
Y
 
K
L
 
V
A
 
A
G
 
G
Y
 
Y
T
 
V
V
 
L
C
 
V
N
 
N
D
|
D
Y
 
V
A
 
S
I
 
E
R
 
R
D
 
F
Y
 
N
L
 
Q
E
 
K
N
 
Q
Y
 
R
Y
 
G
R
 
T
P
 
Q
N
 
W
L
 
S
R
 
K
V
 
G
K
|
K
N
 
G
R
 
H
D
 
D
A
 
T
T
 
F
T
 
C
P
 
P
V
 
V
G
 
G
P
 
P
W
 
W
I
 
L
V
 
V
D
 
T
V
 
P
A
 
D
D
 
E
V
 
V
P
 
G
D
 
D
P
 
P
G
 
Q
N
 
D
L
 
L
T
 
D
L
 
V
R
 
H
T
 
L
W
 
D
I
 
V
N
 
N
G
 
G
E
 
E
L
 
R
R
 
M
Q
 
Q
E
 
T
G
 
G
S
 
N
T
 
T
R
 
K
D
 
T
M
 
M
I
 
I
F
 
F
D
 
N
I
 
V
P
 
A
Y
 
Q
L
 
L
I
 
I
E
 
S
Y
 
Y
L
 
V
S
 
S
S
 
E
F
 
Y
M
 
I
T
 
T
L
 
L
Q
 
Y
P
 
P
G
 
G
D
 
D
M
 
L
I
 
M
A
 
I
T
 
T
G
|
G
T
 
T
P
 
P
E
 
P
G
 
G
L
 
V
A
 
G
D
 
E

8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
39% identity, 71% coverage: 42:222/256 of query aligns to 69:249/290 of 8gsrA

query
sites
8gsrA
A
 
G
T
 
I
G
 
G
N
 
K
M
 
I
F
 
V
A
 
A
L
 
I
G
 
G
L
 
L
N
 
N
Y
 
Y
A
 
E
D
 
D
H
 
H
A
 
A
A
 
I
E
 
E
L
 
S
A
 
N
F
 
L
T
 
P
P
 
I
P
 
P
T
 
T
E
 
E
P
 
P
L
 
M
A
 
M
F
 
F
I
 
M
K
 
K
S
 
A
V
 
L
G
 
S
T
 
S
Y
 
L
T
 
N
G
 
G
H
 
P
R
 
N
H
 
D
V
 
E
T
 
V
W
 
V
R
 
L
P
 
P
D
 
K
N
 
N
V
 
S
A
 
T
Y
 
H
M
 
G
H
 
D
Y
 
W
E
|
E
C
 
V
E
|
E
L
 
L
V
 
G
A
 
V
V
 
V
I
 
I
G
 
G
K
 
E
A
 
T
A
 
C
R
 
R
N
 
F
V
 
V
K
 
S
R
 
E
A
 
D
D
 
E
A
 
A
L
 
L
D
 
S
Y
 
K
L
 
V
A
 
A
G
 
G
Y
 
Y
T
 
V
V
 
L
C
 
V
N
 
N
D
|
D
Y
 
V
A
 
S
I
 
E
R
 
R
D
 
F
Y
 
N
L
 
Q
E
 
K
N
 
Q
Y
 
R
Y
 
G
R
 
T
P
 
Q
N
 
W
L
 
S
R
 
K
V
 
G
K
 
K
N
 
G
R
 
H
D
 
D
A
 
T
T
 
F
T
 
C
P
 
P
V
 
V
G
 
G
P
 
P
W
 
W
I
 
L
V
 
V
D
 
T
V
 
P
A
 
D
D
 
E
V
 
V
P
 
G
D
 
D
P
 
P
G
 
Q
N
 
D
L
 
L
T
 
D
L
 
V
R
 
H
T
 
L
W
 
D
I
 
V
N
 
N
G
 
G
E
 
E
L
 
R
R
 
M
Q
 
Q
E
 
T
G
 
G
S
 
N
T
 
T
R
 
K
D
 
T
M
 
M
I
 
I
F
 
F
D
 
N
I
 
V
P
 
A
Y
 
Q
L
 
L
I
 
I
E
 
S
Y
 
Y
L
 
V
S
 
S
S
 
E
F
 
Y
M
 
I
T
 
T
L
 
L
Q
 
Y
P
 
P
G
 
G
D
 
D
M
 
L
I
 
M
A
 
I
T
 
T
G
 
G
T
 
T
P
 
P
E
 
P
G
 
G
L
 
V
A
 
G
D
 
E

6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
37% identity, 80% coverage: 41:245/256 of query aligns to 67:277/279 of 6v77B

query
sites
6v77B
P
 
P
A
 
L
T
 
P
G
 
R
N
 
Q
M
 
V
F
 
F
A
 
A
L
 
V
G
 
G
L
 
L
N
 
N
Y
 
Y
A
 
D
D
 
D
H
 
H
A
 
A
A
 
T
E
 
E
L
 
S
A
 
G
F
 
L
T
 
S
P
 
K
P
 
P
T
 
E
E
 
H
P
 
P
L
 
V
A
 
I
F
 
F
I
 
T
K
 
K
S
 
F
V
 
V
G
 
S
T
 
S
Y
 
I
T
 
T
G
 
G
H
 
P
R
 
V
H
 
E
V
 
T
T
 
V
W
 
Q
R
 
L
P
 
P
D
 
-
N
 
-
V
 
A
A
 
G
Y
 
S
M
 
V
H
 
D
Y
 
W
E
|
E
C
 
V
E
|
E
L
 
L
V
 
V
A
 
V
V
 
V
I
 
M
G
 
G
K
 
R
A
 
G
A
 
G
R
 
R
N
 
N
V
 
I
K
 
P
R
 
E
A
 
D
D
 
R
A
 
A
L
 
W
D
 
E
Y
 
F
L
 
V
A
 
A
G
 
G
Y
 
V
T
 
S
V
 
V
C
 
G
N
 
Q
D
|
D
Y
 
L
A
 
S
I
 
E
R
 
R
D
 
D
Y
 
L
L
 
Q
E
 
L
N
 
A
Y
 
G
Y
 
P
R
 
A
P
 
P
N
 
Q
L
 
F
R
 
S
V
 
L
-
 
A
K
 
K
N
 
S
R
 
H
D
 
A
A
 
G
T
 
F
T
 
S
P
 
P
V
 
I
G
 
G
P
 
P
W
 
E
I
 
L
V
 
V
D
 
T
V
 
V
A
 
D
D
 
E
V
 
L
P
 
P
D
 
D
P
 
P
G
 
D
N
 
D
L
 
L
T
 
E
L
 
L
R
 
G
T
 
A
W
 
E
I
 
I
N
 
N
G
 
G
E
 
E
L
 
T
R
 
V
Q
 
Q
E
 
H
G
 
S
S
 
R
T
 
T
R
 
S
D
 
Q
M
 
L
I
 
I
F
 
F
D
 
P
I
 
V
P
 
S
Y
 
N
L
 
L
I
 
I
E
 
A
Y
 
Y
L
 
L
S
 
S
S
 
D
F
 
T
M
 
V
T
 
E
L
 
L
Q
 
Y
P
 
P
G
 
G
D
 
D
M
 
V
I
 
I
A
 
F
T
 
T
G
 
G
T
 
T
P
 
P
E
 
S
G
 
G
L
 
V
A
 
G
D
 
M
-
 
G
-
 
R
-
 
N
-
 
P
-
 
K
-
 
R
-
 
F
V
 
L
V
 
A
P
 
P
G
 
G
D
 
D
E
 
E
V
 
L
V
 
R
V
 
T
E
 
Y
V
 
I
E
 
T
G
 
G
V
 
V
G
 
G
R
 
E
L
 
F
V
 
T
N
 
Q
R
 
R
I
 
F
V
 
V
S
 
T

6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
36% identity, 89% coverage: 15:243/256 of query aligns to 45:274/277 of 6iymA

query
sites
6iymA
V
 
M
Q
 
D
V
 
V
E
 
D
A
 
L
D
 
D
N
 
V
A
 
A
V
 
P
R
 
R
L
 
L
D
 
T
D
 
D
G
 
H
-
 
V
R
 
R
L
 
L
L
 
L
A
 
A
E
 
P
D
 
-
Q
 
-
V
 
-
E
 
-
W
 
Y
L
 
L
P
 
P
P
 
P
A
 
R
T
 
-
G
 
-
N
 
N
M
 
V
F
 
I
A
 
C
L
 
V
G
 
G
L
 
K
N
 
N
Y
 
Y
A
 
A
D
 
D
H
 
H
A
 
I
A
 
K
E
 
E
L
 
M
A
 
D
F
 
T
T
 
A
P
 
G
P
 
A
T
 
G
E
 
K
P
 
F
L
 
V
A
 
L
F
 
F
I
 
T
K
 
K
S
 
A
V
 
P
G
 
S
T
 
S
Y
 
I
T
 
V
G
 
G
-
 
P
-
 
F
-
 
D
-
 
P
-
 
I
H
 
E
R
 
R
H
 
H
V
 
A
T
 
-
W
 
-
R
 
-
P
 
-
D
 
D
N
 
L
V
 
T
A
 
Q
Y
 
Q
M
 
L
H
 
D
Y
 
Y
E
|
E
C
 
G
E
|
E
L
 
L
V
 
A
A
 
I
V
 
I
I
 
I
G
 
G
K
 
T
A
 
T
A
 
G
R
 
R
N
 
D
V
 
L
K
 
T
R
 
P
A
 
E
D
 
N
A
 
A
L
 
L
D
 
E
Y
 
H
L
 
V
A
 
F
G
 
G
Y
 
Y
T
 
S
V
 
I
C
 
I
N
 
N
D
|
D
Y
 
V
A
 
T
I
 
A
R
 
R
D
 
D
Y
 
-
L
 
L
E
 
Q
N
 
K
Y
 
E
Y
 
H
R
 
V
P
 
Q
N
 
F
L
 
F
R
 
R
V
 
G
K
 
K
N
 
S
R
 
L
D
 
D
A
 
G
T
 
F
T
 
C
P
 
P
V
 
F
G
 
G
P
 
P
W
 
V
I
 
I
V
 
V
D
 
-
V
 
T
A
 
E
D
 
D
V
 
A
P
 
F
D
 
D
P
 
P
G
 
A
N
 
D
L
 
V
T
 
L
L
 
V
R
 
E
T
 
T
W
 
R
I
 
V
N
 
N
G
 
G
E
 
E
L
 
L
R
 
R
Q
 
Q
E
 
S
G
 
G
S
 
S
T
 
T
R
 
K
D
 
L
M
 
M
I
 
L
F
 
R
D
 
D
I
 
V
P
 
V
Y
 
T
L
 
I
I
 
L
E
 
T
Y
 
E
L
 
V
S
 
S
S
 
R
F
 
G
M
 
M
T
 
T
L
 
L
Q
 
E
P
 
A
G
 
G
D
 
D
M
 
V
I
 
I
A
 
A
T
 
T
G
 
G
T
 
T
P
 
P
E
 
A
G
 
G
L
 
V
A
 
G
D
 
H
-
 
G
-
 
M
-
 
K
-
 
P
-
 
P
-
 
V
-
 
Y
V
 
L
V
 
Q
P
 
D
G
 
G
D
 
D
E
 
V
V
 
I
V
 
D
V
 
V
E
 
S
V
 
I
E
 
E
G
 
G
V
 
I
G
 
G
R
 
H
L
 
L
V
 
Q
N
 
N
R
 
Q
I
 
V

6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
33% identity, 93% coverage: 8:245/256 of query aligns to 45:262/264 of 6jvwB

query
sites
6jvwB
F
 
F
E
 
E
N
 
G
E
 
L
I
 
R
H
 
G
A
 
A
V
 
I
Q
 
E
V
 
A
E
 
A
A
 
L
D
 
P
N
 
G
A
 
L
V
 
A
R
 
R
L
 
I
D
 
P
D
 
L
G
 
A
R
 
Q
L
 
V
L
 
S
A
 
L
E
 
E
D
 
T
Q
 
P
V
 
V
E
 
P
W
 
W
L
 
-
P
 
-
P
 
-
A
 
-
T
 
P
G
 
N
N
 
K
M
 
I
F
 
I
A
 
A
L
 
Y
G
 
P
L
x
V
N
 
N
Y
 
Y
A
 
H
D
 
A
H
 
H
A
 
G
A
 
N
E
 
Q
-
 
G
-
 
F
-
x
F
-
 
L
-
 
K
-
 
P
-
 
G
L
 
S
A
 
A
F
 
L
T
 
S
P
 
G
P
 
P
T
 
T
E
 
D
P
 
P
L
 
V
A
 
V
F
 
L
I
 
P
K
 
A
S
 
V
V
 
P
G
 
G
T
 
-
Y
 
-
T
 
-
G
 
-
H
 
-
R
 
R
H
 
E
V
 
V
T
 
-
W
 
-
R
 
-
P
 
-
D
 
-
N
 
-
V
 
-
A
 
-
Y
 
-
M
 
-
H
 
H
Y
 
H
E
|
E
C
 
S
E
|
E
L
 
L
V
 
A
A
 
I
V
 
I
I
 
I
G
 
G
K
 
K
A
 
T
A
 
C
R
 
R
N
 
S
V
 
V
K
 
A
R
 
R
A
 
E
D
 
D
A
 
W
L
 
K
D
 
D
Y
 
V
L
 
V
A
 
F
G
 
G
Y
 
Y
T
 
A
V
 
C
C
 
L
N
 
L
D
|
D
Y
 
M
A
 
V
I
 
V
R
 
R
D
 
G
Y
 
R
L
 
V
E
 
-
N
 
-
Y
 
-
Y
 
F
R
 
R
P
 
-
N
 
-
L
 
-
R
 
-
V
 
-
K
|
K
N
 
A
R
 
Y
D
 
D
A
 
T
T
 
F
T
 
C
P
 
P
V
 
V
G
 
G
P
 
P
W
 
W
I
 
I
V
 
T
D
 
T
V
 
A
A
 
D
D
 
A
V
 
V
P
 
N
D
 
D
P
 
P
G
 
A
N
 
T
L
 
L
T
 
D
L
 
M
R
 
K
T
 
L
W
 
W
I
 
V
N
 
N
G
 
D
E
 
D
L
 
L
R
 
R
Q
 
Q
E
 
K
G
 
A
S
 
N
T
 
T
R
 
R
D
 
D
M
 
L
I
 
V
F
 
L
D
 
D
I
 
I
P
 
P
Y
 
G
L
 
M
I
 
I
E
 
A
Y
 
T
L
 
A
S
 
S
S
 
A
F
 
V
M
 
M
T
 
T
L
 
L
Q
 
Q
P
 
P
G
 
G
D
 
D
M
 
I
I
 
I
A
 
A
T
 
T
G
 
G
T
 
T
P
 
P
E
 
E
G
 
G
L
 
V
A
 
G
D
 
P
V
 
V
V
 
V
P
 
D
G
 
G
D
 
D
E
 
R
V
 
I
V
 
R
V
 
I
E
 
V
V
 
I
E
 
D
G
 
Q
V
 
V
G
 
G
R
 
E
L
 
M
V
 
A
N
 
V
R
 
D
I
 
V
V
 
V
S
 
Q

4dbhA Crystal structure of cg1458 with inhibitor (see paper)
36% identity, 86% coverage: 25:244/256 of query aligns to 50:267/269 of 4dbhA

query
sites
4dbhA
L
 
L
D
 
K
D
 
D
G
 
V
R
 
R
L
 
L
L
 
L
A
 
A
E
 
-
D
 
-
Q
 
-
V
 
-
E
 
-
W
 
-
L
 
-
P
 
P
P
 
M
A
 
L
T
 
P
G
 
S
N
 
K
M
 
V
F
 
V
A
 
A
L
 
I
G
|
G
L
x
R
N
 
N
Y
 
Y
A
 
A
D
 
D
H
|
H
A
 
V
A
 
A
E
 
E
L
 
V
A
 
-
F
 
F
T
 
K
P
 
K
P
 
S
T
 
A
E
 
E
-
 
S
-
 
L
-
 
P
P
 
P
L
 
T
A
 
L
F
|
F
I
 
L
K
 
K
S
 
P
V
 
P
G
 
T
T
 
A
Y
 
V
T
 
T
G
 
G
H
 
P
R
 
E
H
 
S
V
 
P
T
 
I
W
 
R
R
 
I
P
 
P
D
 
S
N
 
F
V
 
A
A
 
T
Y
 
K
M
 
V
H
 
E
Y
 
F
E
|
E
C
 
G
E
|
E
L
 
L
V
 
A
A
 
V
V
 
V
I
 
I
G
 
G
K
 
K
A
 
P
A
 
C
R
 
K
N
 
N
V
 
V
K
 
K
R
 
A
A
 
D
D
 
D
A
 
W
L
 
K
D
 
S
Y
 
V
L
 
V
A
 
L
G
 
G
Y
 
F
T
 
T
V
 
I
C
 
I
N
 
N
D
|
D
Y
 
V
A
 
S
I
 
S
R
 
R
D
 
D
Y
 
-
L
 
L
E
 
Q
N
 
F
Y
 
A
Y
 
D
R
 
G
P
 
Q
N
 
W
L
 
A
R
 
R
V
 
A
K
|
K
N
 
G
R
 
I
D
 
D
A
 
T
T
 
F
T
 
G
P
 
P
V
 
I
G
 
G
P
 
P
W
 
W
I
 
I
V
 
E
D
 
T
V
 
D
A
 
I
D
 
N
V
 
S
P
 
I
D
 
D
P
 
L
G
 
D
N
 
N
L
 
L
T
 
P
L
 
I
R
 
K
T
 
A
W
 
R
I
 
L
-
 
T
-
 
H
N
 
D
G
 
G
E
 
E
-
 
T
-
 
Q
L
 
L
R
 
K
Q
 
Q
E
 
D
G
 
S
S
 
N
T
 
S
R
 
N
D
 
Q
M
 
M
I
 
I
F
 
M
D
 
K
I
 
M
P
 
G
Y
 
E
L
 
I
I
 
I
E
 
E
Y
 
F
L
 
I
S
 
T
S
 
A
F
 
S
M
 
M
T
 
T
L
 
L
Q
 
L
P
 
P
G
 
G
D
 
D
M
 
V
I
 
I
A
 
A
T
 
T
G
 
G
T
x
S
P
 
P
E
 
A
G
 
G
L
 
T
A
 
E
D
 
A
V
 
M
V
 
V
P
 
D
G
 
G
D
 
D
E
 
Y
V
 
I
V
 
E
V
 
I
E
 
E
V
 
I
E
 
P
G
 
G
V
 
I
G
 
G
R
 
K
L
 
L
V
 
G
N
 
N
R
 
P
I
 
V
V
 
V

6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
31% identity, 96% coverage: 1:246/256 of query aligns to 1:279/280 of 6j5xB

query
sites
6j5xB
M
 
M
K
 
R
R
 
L
A
 
A
R
 
T
I
 
I
R
 
R
F
 
T
E
 
N
N
 
G
E
 
T
I
 
T
H
 
I
A
 
A
V
 
A
Q
 
R
V
 
V
E
 
E
A
 
S
D
 
E
N
 
N
A
 
T
V
 
A
R
 
T
L
 
T
D
 
I
D
 
E
G
 
G
-
 
F
-
 
A
-
 
N
-
 
V
-
 
G
-
 
E
-
 
L
-
 
L
-
 
Q
-
 
E
-
 
S
-
 
N
-
 
W
R
 
R
L
 
E
L
 
L
A
 
A
E
 
E
D
 
N
-
 
A
-
 
A
-
 
G
-
 
E
-
 
A
-
 
V
-
 
T
-
 
F
-
 
E
-
 
N
-
 
K
Q
 
E
V
 
L
E
 
D
W
 
A
L
 
V
P
 
V
P
 
P
A
 
A
T
 
P
G
 
K
N
 
K
M
 
I
F
 
V
A
 
C
L
x
V
G
|
G
L
 
L
N
 
N
Y
 
Y
A
 
A
D
 
N
H
|
H
A
 
I
A
 
K
E
 
E
L
 
M
A
 
G
F
 
R
T
 
D
P
 
L
P
 
P
T
 
D
E
 
T
P
 
P
L
 
T
A
 
L
F
|
F
I
 
V
K
 
K
S
 
F
V
 
P
G
 
D
T
 
A
Y
 
L
T
 
I
G
 
G
H
 
P
R
 
F
H
 
D
V
 
D
T
 
V
W
 
V
R
 
V
P
 
P
D
 
E
-
 
W
-
 
A
N
 
N
V
 
K
A
 
A
Y
 
-
M
 
L
H
 
D
Y
 
W
E
|
E
C
 
G
E
|
E
L
 
M
V
 
A
A
 
V
V
 
I
I
 
I
G
 
G
K
 
K
A
 
R
A
 
A
R
 
R
N
 
R
V
 
V
K
 
K
R
 
Q
A
 
A
D
 
D
A
 
A
L
 
A
D
 
E
Y
 
Y
L
 
I
A
 
A
G
 
G
Y
 
Y
T
 
A
V
 
V
C
 
M
N
 
N
D
|
D
Y
 
Y
A
 
T
I
 
T
R
 
R
D
 
D
Y
 
F
L
 
-
E
 
-
N
 
Q
Y
 
Y
Y
 
A
R
 
A
P
 
P
N
 
A
L
 
K
-
 
T
-
 
P
-
 
Q
-
x
W
-
 
H
R
 
Q
V
 
G
K
|
K
N
 
S
R
 
L
D
 
E
A
 
K
T
 
S
T
 
A
P
 
G
V
 
F
G
 
G
P
 
P
W
 
W
I
 
M
V
 
T
D
 
-
V
 
-
A
 
-
D
 
-
V
 
T
P
 
P
D
 
D
P
 
S
G
 
F
N
 
E
L
 
F
-
 
G
-
 
G
T
 
E
L
 
L
R
 
A
T
 
T
W
 
Y
I
 
L
N
 
E
G
 
G
E
 
E
L
 
K
R
 
V
Q
 
Q
E
 
S
G
 
T
S
 
P
T
 
T
R
 
N
D
 
D
M
 
L
I
 
V
F
 
F
D
 
S
I
 
P
P
 
E
Y
 
K
L
 
L
I
 
I
E
 
E
Y
 
Y
L
 
I
S
 
T
S
 
H
F
 
I
M
 
Y
T
 
P
L
 
L
Q
 
D
P
 
A
G
 
G
D
 
D
M
 
V
I
 
I
A
 
V
T
 
T
G
|
G
T
|
T
P
 
P
E
 
G
G
 
G
L
 
V
A
 
G
D
 
H
-
 
A
-
 
R
-
 
N
-
 
P
-
 
Q
-
 
R
-
 
Y
V
 
I
V
 
G
P
 
D
G
 
G
D
 
E
E
 
T
V
 
V
V
 
K
V
 
V
E
 
E
V
 
I
E
 
A
G
 
G
V
 
L
G
 
G
R
 
F
L
 
I
V
 
E
N
 
N
R
 
K
I
 
T
V
 
V
S
 
F
E
 
E

6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
31% identity, 96% coverage: 1:246/256 of query aligns to 1:279/280 of 6j5xA

query
sites
6j5xA
M
 
M
K
 
R
R
 
L
A
 
A
R
 
T
I
 
I
R
 
R
F
 
T
E
 
N
N
 
G
E
 
T
I
 
T
H
 
I
A
 
A
V
 
A
Q
 
R
V
 
V
E
 
E
A
 
S
D
 
E
N
 
N
A
 
T
V
 
A
R
 
T
L
 
T
D
 
I
D
 
E
G
 
G
-
 
F
-
 
A
-
 
N
-
 
V
-
 
G
-
 
E
-
 
L
-
 
L
-
 
Q
-
 
E
-
 
S
-
 
N
-
 
W
R
 
R
L
 
E
L
 
L
A
 
A
E
 
E
D
 
N
-
 
A
-
 
A
-
 
G
-
 
E
-
 
A
-
 
V
-
 
T
-
 
F
-
 
E
-
 
N
-
 
K
Q
 
E
V
 
L
E
 
D
W
 
A
L
 
V
P
 
V
P
 
P
A
 
A
T
 
P
G
 
K
N
 
K
M
 
I
F
 
V
A
 
C
L
 
V
G
 
G
L
 
L
N
 
N
Y
 
Y
A
 
A
D
 
N
H
 
H
A
 
I
A
 
K
E
 
E
L
 
M
A
 
G
F
 
R
T
 
D
P
 
L
P
 
P
T
 
D
E
 
T
P
 
P
L
 
T
A
 
L
F
 
F
I
 
V
K
 
K
S
 
F
V
 
P
G
 
D
T
 
A
Y
 
L
T
 
I
G
 
G
H
 
P
R
 
F
H
 
D
V
 
D
T
 
V
W
 
V
R
 
V
P
 
P
D
 
E
-
 
W
-
 
A
N
 
N
V
 
K
A
 
A
Y
 
-
M
 
L
H
 
D
Y
 
W
E
|
E
C
 
G
E
|
E
L
 
M
V
 
A
A
 
V
V
 
I
I
 
I
G
 
G
K
 
K
A
 
R
A
 
A
R
 
R
N
 
R
V
 
V
K
 
K
R
 
Q
A
 
A
D
 
D
A
 
A
L
 
A
D
 
E
Y
 
Y
L
 
I
A
 
A
G
 
G
Y
 
Y
T
 
A
V
 
V
C
 
M
N
 
N
D
|
D
Y
 
Y
A
 
T
I
 
T
R
 
R
D
 
D
Y
 
F
L
 
-
E
 
-
N
 
Q
Y
 
Y
Y
 
A
R
 
A
P
 
P
N
 
A
L
 
K
-
 
T
-
 
P
-
 
Q
-
 
W
-
 
H
R
 
Q
V
 
G
K
 
K
N
 
S
R
 
L
D
 
E
A
 
K
T
 
S
T
 
A
P
 
G
V
 
F
G
 
G
P
 
P
W
 
W
I
 
M
V
 
T
D
 
-
V
 
-
A
 
-
D
 
-
V
 
T
P
 
P
D
 
D
P
 
S
G
 
F
N
 
E
L
 
F
-
 
G
-
 
G
T
 
E
L
 
L
R
 
A
T
 
T
W
 
Y
I
 
L
N
 
E
G
 
G
E
 
E
L
 
K
R
 
V
Q
 
Q
E
 
S
G
 
T
S
 
P
T
 
T
R
 
N
D
 
D
M
 
L
I
 
V
F
 
F
D
 
S
I
 
P
P
 
E
Y
 
K
L
 
L
I
 
I
E
 
E
Y
 
Y
L
 
I
S
 
T
S
 
H
F
 
I
M
 
Y
T
 
P
L
 
L
Q
 
D
P
 
A
G
 
G
D
 
D
M
 
V
I
 
I
A
 
V
T
 
T
G
 
G
T
 
T
P
 
P
E
 
G
G
 
G
L
 
V
A
 
G
D
 
H
-
 
A
-
 
R
-
 
N
-
 
P
-
 
Q
-
 
R
-
 
Y
V
 
I
V
 
G
P
 
D
G
 
G
D
 
E
E
 
T
V
 
V
V
 
K
V
 
V
E
 
E
V
 
I
E
 
A
G
 
G
V
 
L
G
 
G
R
 
F
L
 
I
V
 
E
N
 
N
R
 
K
I
 
T
V
 
V
S
 
F
E
 
E

6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
32% identity, 79% coverage: 45:246/256 of query aligns to 25:233/233 of 6j5yA

query
sites
6j5yA
N
 
R
M
 
V
F
 
Y
A
 
C
L
 
V
G
|
G
L
x
R
N
 
N
Y
 
Y
A
 
A
D
 
A
H
|
H
A
 
A
A
 
R
E
 
E
L
 
M
A
 
G
F
 
F
T
 
D
P
 
P
P
 
E
T
 
R
E
 
E
P
 
P
L
 
P
A
 
F
F
 
F
I
x
F
K
 
C
S
 
K
-
 
P
-
 
A
-
 
D
-
 
A
-
 
V
V
 
V
G
 
P
T
 
V
Y
 
A
T
 
A
G
 
G
H
 
S
R
 
T
H
 
L
V
 
E
T
 
L
W
 
A
R
 
Y
P
 
P
D
 
S
N
 
Q
V
 
T
A
 
G
Y
 
N
M
 
Y
H
 
H
Y
 
Y
E
|
E
C
 
I
E
|
E
L
 
L
V
 
V
A
 
A
V
 
A
I
 
I
G
 
G
K
 
K
A
 
G
A
 
G
R
 
C
N
 
D
V
 
I
K
 
P
R
 
L
A
 
E
D
 
Q
A
 
A
L
 
E
D
 
E
Y
 
H
L
 
V
A
 
W
G
 
G
Y
 
Y
T
 
A
V
 
V
C
 
G
N
 
L
D
|
D
Y
 
M
A
 
T
I
 
R
R
 
R
D
 
D
Y
 
L
-
 
Q
-
 
M
-
 
R
L
 
M
E
 
R
N
 
E
Y
 
M
Y
 
G
R
 
R
P
 
P
N
 
W
L
 
E
R
 
I
V
 
G
K
|
K
N
 
A
R
 
F
D
 
D
A
 
R
T
 
S
T
 
A
P
 
P
V
 
I
G
 
G
P
 
P
W
 
-
I
 
L
V
 
Y
D
 
P
V
 
A
A
 
S
D
 
Q
V
 
V
P
 
G
D
 
H
P
 
P
G
 
R
N
 
H
L
 
A
T
 
A
L
 
I
R
 
S
T
 
L
W
 
Q
I
 
V
N
 
D
G
 
G
E
 
E
L
 
D
R
 
R
Q
 
Q
E
 
R
G
 
S
S
 
D
T
 
I
R
 
D
D
 
Q
M
 
L
I
 
I
F
 
W
D
 
S
I
 
V
P
 
A
Y
 
E
L
 
T
I
 
V
E
 
S
Y
 
Y
L
 
L
S
 
S
S
 
R
F
 
F
M
 
F
T
 
E
L
 
L
Q
 
R
P
 
P
G
 
G
D
 
D
M
 
L
I
 
V
A
 
F
T
 
T
G
 
G
T
|
T
P
 
P
E
 
E
G
 
G
L
 
V
A
 
G
D
 
A
V
 
V
V
 
E
P
 
R
G
 
G
D
 
E
E
 
R
V
 
M
V
 
L
V
 
G
E
 
A
V
 
I
E
 
D
G
 
G
V
 
L
G
 
G
R
 
E
L
 
L
V
 
S
N
 
V
R
 
R
I
 
V
V
 
V
S
 
L
E
 
E

3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
33% identity, 70% coverage: 41:219/256 of query aligns to 60:229/265 of 3r6oA

query
sites
3r6oA
P
 
P
A
 
E
T
 
P
G
 
G
N
 
Q
M
 
V
F
 
I
A
 
A
L
 
L
G
 
G
L
 
F
N
 
N
Y
 
Y
A
 
P
D
 
T
H
 
H
A
 
-
A
 
-
E
 
-
L
 
-
A
 
-
F
 
-
T
 
-
P
 
-
P
 
-
T
 
-
E
 
D
P
 
P
L
 
V
A
 
V
F
 
F
I
 
M
K
 
K
S
 
S
V
 
P
G
 
T
T
 
S
Y
 
I
T
 
S
G
 
G
H
 
P
R
 
R
H
 
D
V
 
A
T
 
V
W
 
I
R
 
A
P
 
P
D
 
R
N
 
T
V
 
S
A
 
H
Y
 
A
M
 
L
H
 
D
Y
 
Y
E
|
E
C
 
I
E
|
E
L
 
I
V
 
A
A
 
V
V
 
V
I
 
I
G
 
G
K
 
K
A
 
P
A
 
G
R
 
Y
N
 
R
V
 
I
K
 
E
R
 
R
A
 
S
D
 
Q
A
 
A
L
 
I
D
 
K
Y
 
H
L
 
V
A
 
A
G
 
G
Y
 
Y
T
 
M
V
 
L
C
 
A
N
 
N
D
|
D
Y
 
I
A
 
T
I
 
A
R
 
R
D
 
D
Y
 
V
L
 
A
E
 
L
N
 
P
Y
 
F
Y
 
G
R
 
Q
P
 
A
N
 
Q
-
 
V
L
 
V
R
 
R
V
 
G
K
 
K
N
 
G
R
 
Y
D
 
P
A
 
T
T
 
F
T
 
C
P
 
P
V
 
T
G
 
G
P
 
P
W
 
W
I
 
L
V
 
F
D
 
T
V
 
T
A
 
G
D
 
S
V
 
D
P
 
T
D
 
T
P
 
F
G
 
E
N
 
T
L
 
F
T
 
D
L
 
F
R
 
E
T
 
L
W
 
R
I
 
I
N
 
N
G
 
G
E
 
E
L
 
L
R
 
R
Q
 
Q
E
 
S
G
 
G
S
 
S
T
 
T
R
 
V
D
 
D
M
 
M
I
 
T
F
 
L
D
 
G
I
 
F
P
 
A
Y
 
E
L
 
V
I
 
V
E
 
E
Y
 
T
L
 
V
S
 
S
S
 
A
F
 
T
M
 
I
T
 
A
L
 
L
Q
 
R
P
 
A
G
 
G
D
 
D
M
 
I
I
 
I
A
 
L
T
 
T
G
 
G
T
 
T
P
 
P
E
 
G
G
 
G

3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
31% identity, 74% coverage: 44:233/256 of query aligns to 16:209/224 of 3v77A

query
sites
3v77A
G
 
G
N
 
K
M
 
I
F
 
V
A
 
C
L
 
V
G
 
G
L
 
R
N
 
N
Y
 
Y
A
 
A
D
 
A
H
 
H
A
 
A
A
 
K
E
 
E
L
 
L
A
 
N
F
 
N
T
 
P
P
 
I
P
 
P
T
 
S
E
 
S
P
 
P
L
 
I
A
 
L
F
 
F
I
 
I
K
 
K
S
 
P
V
 
A
G
 
S
T
 
S
Y
 
A
T
 
V
G
 
P
H
 
F
R
 
G
H
 
P
V
 
V
T
 
F
W
 
S
R
 
I
P
 
P
D
 
K
N
 
D
V
 
Q
A
 
G
Y
 
S
M
 
V
H
 
H
Y
 
H
E
 
E
C
 
L
E
|
E
L
 
I
V
 
A
A
 
I
V
 
L
I
 
I
G
 
G
K
 
K
A
 
A
A
 
L
R
 
S
N
 
R
V
 
A
K
 
S
R
 
T
A
 
E
D
 
Q
A
 
V
L
 
A
D
 
E
Y
 
S
L
 
I
A
 
A
G
 
G
Y
 
I
T
 
G
V
 
L
C
 
G
N
 
L
D
|
D
Y
 
L
A
 
T
I
 
L
R
 
R
D
 
D
-
 
V
-
 
Q
-
 
D
Y
 
Q
L
 
L
E
 
K
N
 
E
Y
 
K
Y
 
G
R
 
H
P
 
P
N
 
W
L
 
E
R
 
R
V
 
A
K
 
K
N
 
S
R
 
F
D
 
D
A
 
G
T
 
A
T
 
C
P
 
P
V
 
L
G
 
T
P
 
E
W
 
F
I
 
V
-
 
A
V
 
V
D
 
N
V
 
L
A
 
A
D
 
S
V
 
E
P
 
D
D
 
E
P
 
W
G
 
Q
N
 
A
L
 
I
T
 
G
L
 
L
R
 
T
T
 
L
W
 
E
I
 
K
N
 
N
G
 
G
E
 
Q
L
 
F
R
 
Q
Q
 
Q
E
 
Q
G
 
G
S
 
S
T
 
S
R
 
A
D
 
E
M
 
M
I
 
L
F
 
F
D
 
P
I
 
I
P
 
L
Y
 
P
L
 
L
I
 
I
E
 
A
Y
x
H
L
 
M
S
 
S
S
 
E
F
x
H
M
 
F
T
 
S
L
 
L
Q
 
Q
P
 
P
G
 
G
D
 
D
M
 
V
I
 
I
A
 
L
T
 
T
G
 
G
T
 
T
P
 
P
E
 
A
G
 
G
L
 
V
A
 
G
D
 
P
V
 
L
V
 
E
P
 
V
G
 
G
D
 
D
E
 
S
V
 
L
V
 
S
V
 
A
E
 
K
V
 
L

1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
27% identity, 75% coverage: 42:233/256 of query aligns to 7:222/247 of 1nkqA

query
sites
1nkqA
A
 
A
T
 
A
G
 
R
N
 
K
M
 
I
F
 
I
A
 
C
L
 
I
G
 
G
L
 
R
N
 
N
Y
 
Y
A
 
A
D
 
A
H
 
H
A
 
I
A
 
K
E
 
E
L
 
L
A
 
N
-
 
N
-
 
Q
-
 
P
-
 
F
-
 
F
F
 
F
T
 
L
P
 
K
P
 
P
T
 
T
E
 
S
-
 
S
-
 
I
-
 
V
-
 
T
P
 
P
L
 
L
A
 
S
F
 
S
I
 
S
K
 
P
S
 
A
V
 
N
G
 
S
T
 
T
Y
 
F
T
 
N
G
 
G
H
 
L
R
 
N
H
 
E
V
 
D
T
 
G
W
 
T
R
 
N
P
 
P
D
 
G
N
 
P
V
 
I
-
 
F
-
 
I
-
 
P
-
 
R
-
 
G
A
 
V
Y
 
K
M
 
V
H
 
H
Y
 
H
E
|
E
C
 
I
E
|
E
L
 
L
V
 
A
A
 
L
V
 
I
I
 
V
G
 
S
K
 
K
A
 
H
A
 
L
R
 
S
N
 
N
V
 
V
-
 
T
-
 
K
-
 
M
K
 
K
R
 
P
A
 
E
D
 
E
A
 
V
L
 
Y
D
 
D
Y
 
S
L
 
I
A
 
S
G
 
G
Y
 
V
T
 
A
V
 
L
C
 
A
N
 
L
D
|
D
Y
 
L
A
 
T
I
 
A
R
 
R
D
 
N
Y
 
V
L
 
Q
E
 
D
N
 
E
Y
 
A
Y
 
K
R
 
K
P
 
K
N
 
G
L
 
L
R
 
P
-
 
W
-
 
T
-
 
I
V
 
S
K
 
K
N
 
G
R
 
F
D
 
D
A
 
T
T
 
F
T
 
M
P
 
P
V
 
I
G
 
S
P
 
A
W
 
I
I
 
V
V
 
S
D
 
R
V
 
E
A
 
K
D
 
F
V
 
S
P
 
S
D
 
Y
P
 
K
G
 
S
N
 
N
L
 
L
T
 
Q
-
 
D
-
 
I
-
 
F
-
 
R
L
 
V
R
 
K
T
 
C
W
 
S
I
 
V
N
 
N
G
 
G
E
 
Q
L
 
L
R
 
R
Q
 
Q
E
 
D
G
 
G
S
 
G
T
 
T
R
 
N
D
 
L
M
 
M
I
 
L
F
 
H
D
 
P
I
 
L
P
 
H
Y
 
K
L
 
I
I
 
L
E
 
Q
Y
 
H
L
 
I
S
 
S
S
 
T
F
 
M
M
 
I
T
 
S
L
 
L
Q
 
E
P
 
P
G
 
G
D
 
D
M
 
I
I
 
I
A
 
L
T
 
T
G
 
G
T
 
T
P
 
P
E
 
A
G
 
G
L
 
V
A
 
G
D
 
E
V
 
L
V
 
K
P
 
P
G
 
G
D
 
D
E
 
R
V
 
V
V
 
H
V
 
C
E
 
E
V
 
L

Query Sequence

>GFF3483 FitnessBrowser__WCS417:GFF3483
MKRARIRFENEIHAVQVEADNAVRLDDGRLLAEDQVEWLPPATGNMFALGLNYADHAAEL
AFTPPTEPLAFIKSVGTYTGHRHVTWRPDNVAYMHYECELVAVIGKAARNVKRADALDYL
AGYTVCNDYAIRDYLENYYRPNLRVKNRDATTPVGPWIVDVADVPDPGNLTLRTWINGEL
RQEGSTRDMIFDIPYLIEYLSSFMTLQPGDMIATGTPEGLADVVPGDEVVVEVEGVGRLV
NRIVSEADFFSARKEA

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory