SitesBLAST
Comparing GFF3484 FitnessBrowser__WCS417:GFF3484 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2d4eC Crystal structure of the hpcc from thermus thermophilus hb8
49% identity, 99% coverage: 4:485/486 of query aligns to 29:514/515 of 2d4eC
- active site: N173 (= N146), K196 (= K169), E271 (= E242), C305 (= C276), E409 (= E380), E486 (= E457)
- binding nicotinamide-adenine-dinucleotide: I169 (≠ V142), T170 (≠ S143), P171 (= P144), W172 (= W145), K196 (= K169), A198 (≠ S171), G229 (= G202), G233 (= G206), A234 (≠ D207), T248 (= T221), G249 (= G222), E250 (≠ G223), T253 (= T226), E271 (= E242), L272 (= L243), C305 (= C276), E409 (= E380), F411 (= F382), F475 (= F446)
Q9H2A2 2-aminomuconic semialdehyde dehydrogenase; Aldehyde dehydrogenase 12; Aldehyde dehydrogenase family 8 member A1; EC 1.2.1.32 from Homo sapiens (Human) (see paper)
40% identity, 98% coverage: 1:474/486 of query aligns to 9:485/487 of Q9H2A2
- R109 (= R101) mutation to A: About 65-fold loss of catalytic efficiency.
- N155 (= N146) mutation to A: Complete loss of activity.
- R451 (= R440) mutation to A: Complete loss of activity.
P20000 Aldehyde dehydrogenase, mitochondrial; ALDH class 2; ALDH-E2; ALDHI; EC 1.2.1.3 from Bos taurus (Bovine) (see 2 papers)
44% identity, 95% coverage: 13:476/486 of query aligns to 53:515/520 of P20000
Sites not aligning to the query:
- 1:21 modified: transit peptide, Mitochondrion
4fr8A Crystal structure of human aldehyde dehydrogenase-2 in complex with nitroglycerin (see paper)
42% identity, 95% coverage: 13:476/486 of query aligns to 26:488/493 of 4fr8A
- active site: N162 (= N146), K185 (= K169), Q261 (≠ E242), C295 (= C276), E392 (= E380), E469 (= E457)
- binding nicotinamide-adenine-dinucleotide: I158 (≠ V142), I159 (≠ S143), W161 (= W145), K185 (= K169), G218 (= G202), G222 (= G206), A223 (≠ D207), F236 (= F220), G238 (= G222), S239 (≠ G223), I242 (≠ T226), Q342 (≠ H323), K345 (= K326), E392 (= E380), F394 (= F382)
- binding propane-1,2,3-triyl trinitrate: F163 (≠ V147), L166 (≠ M150), W170 (= W154), F289 (≠ S270), S294 (≠ R275), C295 (= C276), D450 (≠ N438), F452 (≠ R440)
4fr8C Crystal structure of human aldehyde dehydrogenase-2 in complex with nitroglycerin (see paper)
42% identity, 95% coverage: 13:476/486 of query aligns to 29:491/496 of 4fr8C
- active site: N165 (= N146), K188 (= K169), Q264 (≠ E242), C298 (= C276), E395 (= E380), E472 (= E457)
- binding nicotinamide-adenine-dinucleotide: I161 (≠ V142), I162 (≠ S143), W164 (= W145), K188 (= K169), G221 (= G202), G225 (= G206), A226 (≠ D207), F239 (= F220), G241 (= G222), S242 (≠ G223), I245 (≠ T226), Q345 (≠ H323), E395 (= E380), F397 (= F382)
5l13A Structure of aldh2 in complex with 2p3 (see paper)
43% identity, 95% coverage: 13:476/486 of query aligns to 27:489/494 of 5l13A
- active site: N163 (= N146), K186 (= K169), E262 (= E242), C296 (= C276), E393 (= E380), E470 (= E457)
- binding 2,3,5-trimethyl-6-propyl-7H-furo[3,2-g][1]benzopyran-7-one: F164 (≠ V147), M168 (≠ T151), W171 (= W154), F290 (≠ S270), C295 (≠ R275), C296 (= C276), C297 (≠ T277), D451 (≠ N438), F453 (≠ R440)
4kwgA Crystal structure analysis of aldh2+aldib13 (see paper)
43% identity, 95% coverage: 13:476/486 of query aligns to 27:489/494 of 4kwgA
- active site: N163 (= N146), K186 (= K169), E262 (= E242), C296 (= C276), E393 (= E380), E470 (= E457)
- binding 7-bromo-5-methyl-1H-indole-2,3-dione: F164 (≠ V147), M168 (≠ T151), C295 (≠ R275), C296 (= C276), C297 (≠ T277), D451 (≠ N438), F453 (≠ R440)
4kwfA Crystal structure analysis of aldh2+aldib33 (see paper)
43% identity, 95% coverage: 13:476/486 of query aligns to 27:489/494 of 4kwfA
- active site: N163 (= N146), K186 (= K169), E262 (= E242), C296 (= C276), E393 (= E380), E470 (= E457)
- binding 1-benzyl-1H-indole-2,3-dione: F164 (≠ V147), M168 (≠ T151), W171 (= W154), E262 (= E242), C295 (≠ R275), C296 (= C276), C297 (≠ T277), D451 (≠ N438), F453 (≠ R440), F459 (= F446)
3sz9A Crystal structure of human aldh2 modified with the beta-elimination product of aldi-3; 1-(4-ethylbenzene)prop-2-en-1-one (see paper)
43% identity, 95% coverage: 13:476/486 of query aligns to 27:489/494 of 3sz9A
- active site: N163 (= N146), K186 (= K169), E262 (= E242), C296 (= C276), E393 (= E380), E470 (= E457)
- binding 1-(4-ethylphenyl)propan-1-one: F164 (≠ V147), C295 (≠ R275), C296 (= C276), D451 (≠ N438), F453 (≠ R440), F459 (= F446)
3injA Human mitochondrial aldehyde dehydrogenase complexed with agonist alda-1 (see paper)
43% identity, 95% coverage: 13:476/486 of query aligns to 27:489/494 of 3injA
- active site: N163 (= N146), K186 (= K169), E262 (= E242), C296 (= C276), E393 (= E380), E470 (= E457)
- binding N-(1,3-benzodioxol-5-ylmethyl)-2,6-dichlorobenzamide: M118 (≠ R101), F164 (≠ V147), L167 (≠ M150), F286 (= F266), F290 (≠ S270), D451 (≠ N438), F453 (≠ R440)
2vleA The structure of daidzin, a naturally occurring anti alcohol- addiction agent, in complex with human mitochondrial aldehyde dehydrogenase (see paper)
43% identity, 95% coverage: 13:476/486 of query aligns to 27:489/494 of 2vleA
- active site: N163 (= N146), K186 (= K169), E262 (= E242), C296 (= C276), E393 (= E380), E470 (= E457)
- binding daidzin: M118 (≠ R101), F164 (≠ V147), M168 (≠ T151), W171 (= W154), F286 (= F266), F290 (≠ S270), C295 (≠ R275), C296 (= C276), D451 (≠ N438), V452 (= V439), F453 (≠ R440)
1o01B Human mitochondrial aldehyde dehydrogenase complexed with crotonaldehyde, NAD(h) and mg2+ (see paper)
43% identity, 95% coverage: 13:476/486 of query aligns to 27:489/494 of 1o01B
- active site: N163 (= N146), K186 (= K169), E262 (= E242), C296 (= C276), E393 (= E380), E470 (= E457)
- binding (2e)-but-2-enal: C296 (= C276), C297 (≠ T277), F453 (≠ R440)
- binding nicotinamide-adenine-dinucleotide: I159 (≠ V142), I160 (≠ S143), P161 (= P144), W162 (= W145), K186 (= K169), E189 (= E172), G219 (= G202), G223 (= G206), A224 (≠ D207), F237 (= F220), G239 (= G222), S240 (≠ G223), I243 (≠ T226), L263 (= L243), G264 (= G244), C296 (= C276), Q343 (≠ H323), E393 (= E380), F395 (= F382)
1cw3A Human mitochondrial aldehyde dehydrogenase complexed with NAD+ and mn2+ (see paper)
43% identity, 95% coverage: 13:476/486 of query aligns to 27:489/494 of 1cw3A
- active site: N163 (= N146), K186 (= K169), E262 (= E242), C296 (= C276), E393 (= E380), E470 (= E457)
- binding magnesium ion: V34 (≠ Y20), D103 (= D86), Q190 (≠ L173)
- binding nicotinamide-adenine-dinucleotide: I159 (≠ V142), I160 (≠ S143), P161 (= P144), W162 (= W145), K186 (= K169), G219 (= G202), G223 (= G206), A224 (≠ D207), F237 (= F220), G239 (= G222), S240 (≠ G223), I243 (≠ T226), L263 (= L243), G264 (= G244), C296 (= C276), Q343 (≠ H323), K346 (= K326), E393 (= E380), F395 (= F382)
4npiA 1.94 angstroms x-ray crystal structure of NAD- and intermediate- bound alpha-aminomuconate-epsilon-semialdehyde dehydrogenase from pseudomonas fluorescens (see paper)
40% identity, 97% coverage: 4:476/486 of query aligns to 5:483/483 of 4npiA
- active site: N152 (= N146), K175 (= K169), E251 (= E242), C285 (= C276), E387 (= E380), E464 (= E457)
- binding (2Z,4E)-2-hydroxy-6-oxohexa-2,4-dienoic acid: R103 (= R101), L157 (≠ T151), W160 (= W154), E251 (= E242), C285 (= C276), Y445 (≠ N438), R447 (= R440), F453 (= F446)
- binding nicotinamide-adenine-dinucleotide: I148 (≠ V142), S149 (= S143), P150 (= P144), W151 (= W145), K175 (= K169), E178 (= E172), G208 (= G202), G213 (= G206), E214 (≠ D207), F227 (= F220), G229 (= G222), E230 (≠ G223), T233 (= T226), G253 (= G244), C285 (= C276), K335 (= K326), E387 (= E380), F389 (= F382)
4i2rA 2.15 angstroms x-ray crystal structure of NAD- and alternative substrate-bound 2-aminomuconate 6-semialdehyde dehydrogenase from pseudomonas fluorescens (see paper)
40% identity, 97% coverage: 4:476/486 of query aligns to 5:483/483 of 4i2rA
- active site: N152 (= N146), K175 (= K169), E251 (= E242), C285 (= C276), E387 (= E380), E464 (= E457)
- binding (2E,4E)-2-hydroxy-6-oxohexa-2,4-dienoic acid: R103 (= R101), L157 (≠ T151), C285 (= C276), Y445 (≠ N438), R447 (= R440), F453 (= F446)
- binding nicotinamide-adenine-dinucleotide: I148 (≠ V142), S149 (= S143), W151 (= W145), N152 (= N146), K175 (= K169), E178 (= E172), G208 (= G202), F227 (= F220), T228 (= T221), G229 (= G222), E230 (≠ G223), T233 (= T226), E251 (= E242), L252 (= L243), G253 (= G244), C285 (= C276), E387 (= E380), F389 (= F382)
4i25A 2.00 angstroms x-ray crystal structure of NAD- and substrate-bound 2- aminomuconate 6-semialdehyde dehydrogenase from pseudomonas fluorescens (see paper)
40% identity, 97% coverage: 4:476/486 of query aligns to 5:483/483 of 4i25A
- active site: N152 (= N146), K175 (= K169), E251 (= E242), C285 (= C276), E387 (= E380), E464 (= E457)
- binding (2E,4E)-2-amino-6-oxohexa-2,4-dienoic acid: R103 (= R101), L157 (≠ T151), C285 (= C276), Y445 (≠ N438), R447 (= R440), F453 (= F446)
- binding nicotinamide-adenine-dinucleotide: I148 (≠ V142), S149 (= S143), P150 (= P144), W151 (= W145), N152 (= N146), K175 (= K169), E178 (= E172), G208 (= G202), G213 (= G206), F227 (= F220), T228 (= T221), G229 (= G222), E230 (≠ G223), T233 (= T226), E251 (= E242), L252 (= L243), C285 (= C276), E387 (= E380), F389 (= F382)
1nzwA Cys302ser mutant of human mitochondrial aldehyde dehydrogenase complexed with nadh and mg2+ (see paper)
42% identity, 95% coverage: 13:476/486 of query aligns to 27:489/494 of 1nzwA
- active site: N163 (= N146), K186 (= K169), E262 (= E242), S296 (≠ C276), E393 (= E380), E470 (= E457)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I159 (≠ V142), I160 (≠ S143), P161 (= P144), K186 (= K169), E189 (= E172), G219 (= G202), P220 (≠ A203), G223 (= G206), A224 (≠ D207), F237 (= F220), G239 (= G222), S240 (≠ G223), I243 (≠ T226), E262 (= E242), G264 (= G244), S296 (≠ C276), Q343 (≠ H323), E393 (= E380), F395 (= F382)
5kllA Crystal structure of 2-hydroxymuconate-6-semialdehyde derived tautomeric intermediate in 2-aminomuconate 6-semialdehyde dehydrogenase n169d (see paper)
40% identity, 97% coverage: 4:476/486 of query aligns to 5:483/483 of 5kllA
- active site: D152 (≠ N146), K175 (= K169), E251 (= E242), C285 (= C276), E387 (= E380), E464 (= E457)
- binding (3~{E},5~{E})-6-oxidanyl-2-oxidanylidene-hexa-3,5-dienoic acid: R103 (= R101), D152 (≠ N146), L157 (≠ T151), W160 (= W154), C285 (= C276), Y445 (≠ N438), R447 (= R440), F453 (= F446)
5kj5B Crystal structure of 2-aminomuconate 6-semialdehyde dehydrogenase n169d in complex with NAD+ (see paper)
40% identity, 97% coverage: 4:476/486 of query aligns to 6:484/484 of 5kj5B
- active site: D153 (≠ N146), K176 (= K169), E252 (= E242), C286 (= C276), E388 (= E380), E465 (= E457)
- binding nicotinamide-adenine-dinucleotide: I149 (≠ V142), S150 (= S143), P151 (= P144), W152 (= W145), D153 (≠ N146), L158 (≠ T151), K176 (= K169), G209 (= G202), K210 (≠ A203), G214 (= G206), F228 (= F220), T229 (= T221), G230 (= G222), E231 (≠ G223), T234 (= T226), E252 (= E242), L253 (= L243), C286 (= C276), E388 (= E380), F390 (= F382), F454 (= F446)
4ou2A A 2.15 angstroms x-ray crystal structure of e268a 2-aminomuconate 6- semialdehyde dehydrogenase catalytic intermediate from pseudomonas fluorescens (see paper)
40% identity, 97% coverage: 4:476/486 of query aligns to 5:483/483 of 4ou2A
- active site: N152 (= N146), K175 (= K169), A251 (≠ E242), C285 (= C276), E387 (= E380), E464 (= E457)
- binding (2Z,4E)-2,6-dihydroxyhexa-2,4-dienoic acid: R103 (= R101), L157 (≠ T151), C285 (= C276), Y445 (≠ N438), R447 (= R440), F453 (= F446)
- binding nicotinamide-adenine-dinucleotide: I148 (≠ V142), S149 (= S143), P150 (= P144), W151 (= W145), N152 (= N146), K175 (= K169), G208 (= G202), G213 (= G206), E214 (≠ D207), F227 (= F220), T228 (= T221), G229 (= G222), E230 (≠ G223), T233 (= T226), A251 (≠ E242), L252 (= L243), G253 (= G244), C285 (= C276), E387 (= E380), F389 (= F382)
Query Sequence
>GFF3484 FitnessBrowser__WCS417:GFF3484
MIKHWINGREVESKDTFINYNPATGEAIGEVASGGAEEVALAVAAAKEAFPKWANTPAKE
RARLMRKLGELIEQNVPHLAELETLDTGLPIHQTKNVLIPRASHNFDFFAEVCTRMDGHS
YPVDDQMLNYTLYQPVGVCGLVSPWNVPFMTATWKTAPCLALGNTAVLKMSELSPLTANE
LGRLAVEAGIPNGVLNVIQGYGATAGDALVRHPDVRAISFTGGTATGKKIMQTAGLKKYS
MELGGKSPVLIFEDADLERALDSALFTIFSLNGERCTAGSRIFIQESVYPQFVAEFAARA
KRLIVGDPQDPKTQVGSMITQAHYDKVTGYIKIGIEEGATLLAGGLDRPANLPAHLSKGQ
FIQPTVFADVNNKMRIAQEEIFGPVVCLIPFKDEAEALQLANDTEYGLASYIWTQDIGKA
HRLARGIEAGMVFINSQNVRDLRQPFGGVKGSGTGREGGQYSFEVFAEIKNVCISMGSHH
IPRWGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory