SitesBLAST
Comparing GFF3495 FitnessBrowser__WCS417:GFF3495 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ci9D Rmm microcompartment-associated aminopropanol dehydrogenase NADP + aminoacetone holo-structure (see paper)
46% identity, 97% coverage: 8:251/252 of query aligns to 7:253/259 of 6ci9D
- active site: G20 (= G21), S145 (= S142), Y159 (= Y156)
- binding 1-aminopropan-2-one: F97 (= F94), S145 (= S142), T147 (= T144), W156 (≠ L153), Y159 (= Y156), G190 (= G187)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G17), S18 (≠ A19), G20 (= G21), I21 (= I22), G40 (≠ D41), R41 (= R42), N42 (≠ Q43), D66 (= D67), V67 (≠ L68), N93 (= N90), G95 (= G92), T143 (= T140), S145 (= S142), Y159 (= Y156), K163 (= K160), P189 (= P186), N191 (≠ M188), I192 (= I189), T194 (= T191), G196 (≠ A193), L197 (≠ M194)
3pk0B Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis (see paper)
41% identity, 99% coverage: 2:251/252 of query aligns to 2:255/262 of 3pk0B
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
37% identity, 94% coverage: 11:246/252 of query aligns to 3:252/256 of Q48436
- 6:33 (vs. 14:41, 54% identical) binding
- D59 (= D67) binding
- K156 (= K160) binding
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
37% identity, 94% coverage: 11:246/252 of query aligns to 3:252/256 of 1gegE
- active site: G13 (= G21), S139 (≠ V143), Y152 (= Y156), K156 (= K160), V197 (≠ L202)
- binding alpha-D-glucopyranose: R63 (≠ S71), D64 (≠ Q72), F67 (= F75), E123 (≠ P127)
- binding nicotinamide-adenine-dinucleotide: G9 (= G17), Q12 (= Q20), I14 (= I22), D33 (= D41), Y34 (≠ R42), V58 (= V66), D59 (= D67), V60 (≠ L68), N86 (= N90), A87 (= A91), I109 (≠ V113), S139 (≠ V143), Y152 (= Y156), K156 (= K160), P182 (= P186), V185 (≠ I189), T187 (= T191), M189 (≠ A193)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
38% identity, 94% coverage: 11:246/252 of query aligns to 6:250/256 of 7do7A
- active site: G16 (= G21), S146 (≠ V143), Y159 (= Y156)
- binding nicotinamide-adenine-dinucleotide: G12 (= G17), R15 (≠ Q20), G16 (= G21), I17 (= I22), S37 (vs. gap), D66 (= D67), A67 (≠ L68), N93 (= N90), A94 (= A91), G95 (= G92), I96 (≠ Y93), V144 (≠ S141), S145 (= S142), S146 (≠ V143), Y159 (= Y156), K163 (= K160), P189 (= P186), G190 (= G187), I192 (= I189), T194 (= T191), I196 (≠ A193)
- binding beta-L-rhamnopyranose: F99 (≠ L96), S146 (≠ V143), S148 (≠ G145), Q156 (≠ L153), Y159 (= Y156), N197 (vs. gap), D235 (= D231), M236 (≠ L232), R238 (≠ G234)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
38% identity, 94% coverage: 11:246/252 of query aligns to 6:250/256 of 7b81A
- active site: G16 (= G21), S146 (≠ V143), Y159 (= Y156)
- binding nicotinamide-adenine-dinucleotide: G12 (= G17), S14 (≠ A19), R15 (≠ Q20), I17 (= I22), D66 (= D67), A67 (≠ L68), N93 (= N90), A94 (= A91), G95 (= G92), I96 (≠ Y93), T116 (≠ V113), V144 (≠ S141), S146 (≠ V143), Y159 (= Y156), K163 (= K160), P189 (= P186), G190 (= G187), I192 (= I189), T194 (= T191), I196 (≠ A193)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
38% identity, 94% coverage: 11:246/252 of query aligns to 8:241/244 of 4nbuB
- active site: G18 (= G21), N111 (= N114), S139 (= S142), Q149 (≠ L153), Y152 (= Y156), K156 (= K160)
- binding acetoacetyl-coenzyme a: D93 (≠ L96), K98 (≠ D101), S139 (= S142), N146 (≠ Y150), V147 (≠ P151), Q149 (≠ L153), Y152 (= Y156), F184 (≠ M188), M189 (≠ A193), K200 (≠ T205)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G17), N17 (≠ Q20), G18 (= G21), I19 (= I22), D38 (= D41), F39 (≠ R42), V59 (= V66), D60 (= D67), V61 (≠ L68), N87 (= N90), A88 (= A91), G89 (= G92), I90 (≠ Y93), T137 (= T140), S139 (= S142), Y152 (= Y156), K156 (= K160), P182 (= P186), F184 (≠ M188), T185 (≠ I189), T187 (= T191), M189 (≠ A193)
7do6A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NADP bound-form) (see paper)
38% identity, 94% coverage: 11:246/252 of query aligns to 6:241/247 of 7do6A
- active site: G16 (= G21), S146 (≠ V143), Y159 (= Y156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G17), S14 (≠ A19), R15 (≠ Q20), G16 (= G21), I17 (= I22), H36 (vs. gap), S37 (vs. gap), G42 (≠ Q43), D66 (= D67), A67 (≠ L68), N93 (= N90), A94 (= A91), G95 (= G92), I96 (≠ Y93), T116 (≠ V113), S146 (≠ V143), Y159 (= Y156), K163 (= K160), I192 (= I189)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
39% identity, 96% coverage: 6:246/252 of query aligns to 1:240/244 of 6t77A
- active site: G16 (= G21), S138 (= S142), Y151 (= Y156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G17), S14 (≠ A19), R15 (≠ Q20), T37 (≠ R42), L58 (≠ A63), N59 (≠ V64), V60 (≠ G65), A87 (= A91), G88 (= G92), I89 (≠ Y93)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
40% identity, 95% coverage: 8:246/252 of query aligns to 3:240/244 of 7krmC
- active site: G18 (= G21), S140 (= S142), Y155 (= Y156)
- binding nicotinamide-adenine-dinucleotide: G12 (= G17), S15 (vs. gap), G18 (= G21), I19 (= I22), D38 (= D41), L39 (≠ R42), A60 (≠ V64), N61 (≠ G65), V62 (= V66), N88 (= N90), V111 (= V113), S140 (= S142), Y155 (= Y156), K159 (= K160), I188 (= I189), T190 (= T191)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 96% coverage: 6:246/252 of query aligns to 1:240/244 of P0AEK2
- GASR 12:15 (≠ GGAQ 17:20) binding
- T37 (≠ R42) binding
- NV 59:60 (≠ VG 64:65) binding
- N86 (= N90) binding
- Y151 (= Y156) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YAASK 156:160) binding
- A154 (≠ S159) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K160) mutation to A: Defect in the affinity for NADPH.
- I184 (= I189) binding
- E233 (≠ Q239) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
35% identity, 96% coverage: 8:248/252 of query aligns to 5:259/261 of 6zzsD
- active site: G18 (= G21), S143 (= S142), Y156 (= Y156)
- binding nicotinamide-adenine-dinucleotide: G14 (= G17), S17 (≠ Q20), I19 (= I22), D38 (= D41), M39 (≠ R42), D64 (= D67), V65 (≠ L68), N91 (= N90), A92 (= A91), G93 (= G92), M141 (≠ T140), A142 (≠ S141), S143 (= S142), Y156 (= Y156), K160 (= K160), P186 (= P186), G187 (= G187), V189 (≠ I189), T191 (= T191), L193 (vs. gap)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ F94), S143 (= S142), N145 (≠ T144), K153 (≠ L153), Y156 (= Y156), Q197 (≠ A193)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
35% identity, 96% coverage: 8:248/252 of query aligns to 4:258/260 of 6zzqA
- active site: G17 (= G21), S142 (= S142), Y155 (= Y156)
- binding acetoacetic acid: Q94 (≠ F94), S142 (= S142), K152 (≠ L153), Y155 (= Y156), Q196 (≠ A193)
- binding nicotinamide-adenine-dinucleotide: G13 (= G17), S16 (≠ Q20), G17 (= G21), I18 (= I22), D37 (= D41), M38 (≠ R42), D63 (= D67), V64 (≠ L68), N90 (= N90), A91 (= A91), G92 (= G92), M140 (≠ T140), A141 (≠ S141), S142 (= S142), Y155 (= Y156), K159 (= K160), Y187 (≠ M188), V188 (≠ I189), T190 (= T191)
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
38% identity, 95% coverage: 7:246/252 of query aligns to 1:239/243 of 1q7bA
- active site: G15 (= G21), E101 (≠ L106), S137 (= S142), Q147 (≠ L153), Y150 (= Y156), K154 (= K160)
- binding calcium ion: E232 (≠ Q239), T233 (= T240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G17), S13 (≠ A19), R14 (≠ Q20), T36 (≠ R42), N58 (≠ V64), V59 (≠ G65), N85 (= N90), A86 (= A91), G87 (= G92), I88 (≠ Y93), S137 (= S142), Y150 (= Y156), K154 (= K160), P180 (= P186), G181 (= G187), I183 (= I189)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
38% identity, 96% coverage: 6:246/252 of query aligns to 1:240/244 of P0A2C9
- M125 (≠ F129) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A229) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S230) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
6qheA Alcohol dehydrogenase from arthrobacter sp. Ts-15 in complex with NAD+
35% identity, 98% coverage: 6:251/252 of query aligns to 3:258/261 of 6qheA
- binding nicotinamide-adenine-dinucleotide: G14 (= G17), M17 (≠ Q20), G18 (= G21), M19 (≠ I22), D38 (= D41), R39 (= R42), D63 (= D67), I64 (≠ L68), A90 (≠ N90), A91 (= A91), S142 (= S142), Y156 (= Y156), K160 (= K160), P186 (= P186), G187 (= G187), M189 (≠ I189), T191 (= T191), P192 (= P192), M193 (≠ A193)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
37% identity, 95% coverage: 7:246/252 of query aligns to 1:239/243 of 1q7cA
- active site: G15 (= G21), S137 (= S142), Q147 (≠ L153), F150 (≠ Y156), K154 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G17), S13 (≠ A19), R14 (≠ Q20), A35 (≠ D41), T36 (≠ R42), L57 (≠ A63), N58 (≠ V64), V59 (≠ G65), G87 (= G92), I88 (≠ Y93)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
37% identity, 95% coverage: 8:246/252 of query aligns to 2:239/243 of 7emgB
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
37% identity, 97% coverage: 6:249/252 of query aligns to 1:247/247 of 4jroC
- active site: G16 (= G21), S142 (= S142), Q152 (≠ L153), Y155 (= Y156), K159 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G17), S14 (≠ A19), R15 (≠ Q20), G16 (= G21), I17 (= I22), N35 (≠ A40), Y36 (vs. gap), N37 (≠ D41), G38 (≠ R42), S39 (≠ Q43), N63 (≠ G65), V64 (= V66), N90 (= N90), A91 (= A91), I93 (≠ Y93), I113 (≠ V113), S142 (= S142), Y155 (= Y156), K159 (= K160), P185 (= P186), I188 (= I189), T190 (= T191)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
37% identity, 92% coverage: 14:246/252 of query aligns to 8:243/246 of 3osuA
Query Sequence
>GFF3495 FitnessBrowser__WCS417:GFF3495
MPMNDLDFSGQVVLVTGGAQGIGRGIVKAFVQRGARVVIADRQREQAQAVATELSAQGCR
VEAVGVDLAESQAVFECVQGLPQLDILVHNAGYFPLTAFEDITPDLLQRTLAVNLSALFW
LTQAALPAFRAQGRGCVLVTSSVTGNRVGYPGLSHYAASKAGVNGFIRNAALELAALNVR
VNGVEPGMIATPAMANLGDTALNDTIASRVPLGRLGTAADIAGAMLFLASDLAGYITGQT
LVVDGGSTLPEV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory