SitesBLAST
Comparing GFF3507 FitnessBrowser__psRCH2:GFF3507 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
71% identity, 97% coverage: 6:304/307 of query aligns to 4:304/308 of 6wj9B
- active site: A119 (≠ S118), A120 (= A119), A121 (= A120), F144 (≠ Y143), K148 (= K147)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), F12 (= F14), I13 (= I15), D32 (= D34), D33 (≠ N35), S35 (= S37), T36 (= T38), G37 (= G39), D55 (= D54), A56 (≠ V55), L75 (= L74), A76 (= A75), A77 (= A76), S94 (= S93), A117 (= A116), A119 (≠ S118), F144 (≠ Y143), K148 (= K147), F171 (= F170), F172 (= F171), I174 (= I173)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (= V80), N173 (= N172), G187 (= G186), V188 (= V187), F192 (= F191), T203 (≠ A202), L204 (≠ V203), F205 (= F204), R212 (= R211), L248 (= L247), R271 (= R270), D274 (= D273)
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
71% identity, 97% coverage: 6:304/307 of query aligns to 3:303/307 of 6wjaA
- active site: A118 (≠ S118), A119 (= A119), A120 (= A120), F143 (≠ Y143), K147 (= K147)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (= I15), D31 (= D34), D32 (≠ N35), S34 (= S37), T35 (= T38), G36 (= G39), A55 (≠ V55), L74 (= L74), A75 (= A75), A76 (= A76), S93 (= S93), F143 (≠ Y143), K147 (= K147), F170 (= F170), F171 (= F171), I173 (= I173)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (= V80), A120 (= A120), N172 (= N172), G186 (= G186), V187 (= V187), F191 (= F191), T202 (≠ A202), F204 (= F204), R211 (= R211), L247 (= L247), R270 (= R270), D273 (= D273)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
40% identity, 96% coverage: 6:301/307 of query aligns to 3:297/309 of 4zrnA
- active site: T117 (≠ S118), G119 (≠ A119), A120 (= A120), Y143 (= Y143), K147 (= K147), Y181 (≠ S181), G185 (= G186)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (= I15), D31 (= D34), N32 (= N35), S34 (= S37), S35 (≠ T38), G36 (= G39), S51 (≠ D54), I52 (≠ V55), L73 (= L74), A74 (= A75), A75 (= A76), T92 (≠ S93), S115 (≠ A116), S116 (= S117), Y143 (= Y143), K147 (= K147), Y170 (≠ F170), V173 (≠ I173)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S118), G119 (≠ A119), A120 (= A120), Y143 (= Y143), N172 (= N172), G185 (= G186), V186 (= V187), H201 (≠ A202), F203 (= F204), Y208 (≠ Q209), R210 (= R211), V244 (≠ L247), R267 (= R270), D270 (= D273)
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
41% identity, 93% coverage: 1:284/307 of query aligns to 1:283/310 of 6dntA
- active site: S120 (= S118), S121 (≠ A119), A122 (= A120), Y144 (= Y143), K148 (= K147), A187 (≠ G186)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (= A78), S120 (= S118), S121 (≠ A119), Y144 (= Y143), F172 (= F171), N173 (= N172), A187 (≠ G186), V188 (= V187), K191 (≠ I190), V203 (≠ A202), I204 (≠ V203), Y205 (≠ F204), Q210 (= Q209), R212 (= R211), I246 (≠ L247), R269 (= R270), D272 (= D273)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), G13 (= G13), F14 (= F14), I15 (= I15), D33 (= D34), N34 (= N35), L35 (= L36), S36 (= S37), S37 (≠ T38), G38 (= G39), D57 (= D54), L58 (≠ V55), L76 (= L74), A77 (= A75), A78 (= A76), A80 (= A78), S118 (≠ A116), S119 (= S117), Y144 (= Y143), K148 (= K147), Y171 (≠ F170), V174 (≠ I173)
- binding zinc ion: E209 (= E208), H275 (= H276)
2p5uA Crystal structure of thermus thermophilus hb8 udp-glucose 4-epimerase complex with NAD
44% identity, 96% coverage: 6:301/307 of query aligns to 3:300/311 of 2p5uA
- active site: T117 (≠ S118), G119 (≠ A119), A120 (= A120), Y143 (= Y143), K147 (= K147), H181 (≠ S181), G185 (= G186)
- binding nicotinamide-adenine-dinucleotide: G10 (= G13), F11 (= F14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), A34 (≠ S37), T35 (= T38), G36 (= G39), D51 (= D54), L52 (≠ V55), Q73 (≠ L74), A74 (= A75), A75 (= A76), A77 (= A78), S116 (= S117), Y143 (= Y143), K147 (= K147), V173 (≠ I173)
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
37% identity, 96% coverage: 7:301/307 of query aligns to 20:324/336 of 3ruhA
- active site: S142 (= S118), S143 (≠ A119), S144 (≠ A120), Y166 (= Y143), K170 (= K147), N204 (≠ S181)
- binding nicotinamide-adenine-dinucleotide: G23 (= G10), G26 (= G13), F27 (= F14), I28 (= I15), D47 (= D34), N48 (= N35), S50 (= S37), T51 (= T38), G52 (= G39), D78 (= D54), I79 (≠ V55), Q98 (≠ L74), A99 (= A75), A100 (= A76), T117 (≠ S93), A140 (= A116), A141 (≠ S117), S142 (= S118), Y166 (= Y143), K170 (= K147), Y193 (≠ F170), V196 (≠ I173)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (≠ A78), S103 (= S79), S142 (= S118), S143 (≠ A119), S144 (≠ A120), Y166 (= Y143), Y193 (≠ F170), N195 (= N172), A209 (≠ G186), V210 (= V187), K213 (≠ I190), W214 (≠ F191), Y225 (≠ A202), I226 (≠ V203), N227 (≠ F204), R234 (= R211), L271 (= L247), R294 (= R270), D297 (= D273), V298 (≠ I274), S301 (= S277)
3rufA Alternative analogs as viable substrates of udp-hexose 4-epimerases
37% identity, 96% coverage: 7:301/307 of query aligns to 20:324/336 of 3rufA
- active site: S142 (= S118), S143 (≠ A119), S144 (≠ A120), Y166 (= Y143), K170 (= K147), N204 (≠ S181)
- binding nicotinamide-adenine-dinucleotide: G23 (= G10), G26 (= G13), F27 (= F14), I28 (= I15), D47 (= D34), N48 (= N35), S50 (= S37), T51 (= T38), G52 (= G39), D78 (= D54), I79 (≠ V55), Q98 (≠ L74), A99 (= A75), A100 (= A76), T117 (≠ S93), A140 (= A116), Y166 (= Y143), K170 (= K147), Y193 (≠ F170), V196 (≠ I173)
- binding uridine-5'-diphosphate: N195 (= N172), A209 (≠ G186), V210 (= V187), K213 (≠ I190), W214 (≠ F191), Y225 (≠ A202), I226 (≠ V203), N227 (≠ F204), R234 (= R211), L271 (= L247), R294 (= R270), D297 (= D273)
3lu1A Crystal structure analysis of wbgu: a udp-galnac 4-epimerase (see paper)
37% identity, 96% coverage: 7:301/307 of query aligns to 20:324/336 of 3lu1A
- active site: S142 (= S118), S143 (≠ A119), S144 (≠ A120), Y166 (= Y143), K170 (= K147), N204 (≠ S181)
- binding glycine: Q135 (≠ K111), K187 (≠ E164)
- binding nicotinamide-adenine-dinucleotide: G23 (= G10), G26 (= G13), F27 (= F14), I28 (= I15), D47 (= D34), N48 (= N35), S50 (= S37), T51 (= T38), G52 (= G39), D78 (= D54), I79 (≠ V55), Q98 (≠ L74), A99 (= A75), A100 (= A76), A140 (= A116), A141 (≠ S117), S142 (= S118), Y166 (= Y143), K170 (= K147), Y193 (≠ F170), N195 (= N172)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S79), S142 (= S118), S143 (≠ A119), S144 (≠ A120), Y166 (= Y143), N195 (= N172), V210 (= V187), W214 (≠ F191), Y225 (≠ A202), I226 (≠ V203), N227 (≠ F204), R234 (= R211), L271 (= L247), R294 (= R270), D297 (= D273)
1sb8A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-n-acetylgalactosamine (see paper)
38% identity, 89% coverage: 7:280/307 of query aligns to 20:309/341 of 1sb8A
- active site: S142 (= S118), S143 (≠ A119), S144 (≠ A120), Y166 (= Y143), K170 (= K147), N204 (≠ S181)
- binding nicotinamide-adenine-dinucleotide: G23 (= G10), G26 (= G13), F27 (= F14), I28 (= I15), D47 (= D34), N48 (= N35), F49 (≠ L36), T51 (= T38), G52 (= G39), D78 (= D54), I79 (≠ V55), Q98 (≠ L74), A100 (= A76), T117 (≠ S93), A140 (= A116), A141 (≠ S117), Y166 (= Y143), K170 (= K147), Y193 (≠ F170), N195 (= N172), V196 (≠ I173)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S79), S142 (= S118), S143 (≠ A119), S144 (≠ A120), Y166 (= Y143), N195 (= N172), A209 (≠ G186), V210 (= V187), W214 (≠ F191), Y225 (≠ A202), I226 (≠ V203), N227 (≠ F204), R234 (= R211), L271 (= L247), R299 (= R270), D302 (= D273), S306 (= S277)
1sb9A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-glucose (see paper)
38% identity, 89% coverage: 7:280/307 of query aligns to 19:308/340 of 1sb9A
- active site: S141 (= S118), S142 (≠ A119), S143 (≠ A120), Y165 (= Y143), K169 (= K147), N203 (≠ S181)
- binding nicotinamide-adenine-dinucleotide: G22 (= G10), G25 (= G13), F26 (= F14), I27 (= I15), D46 (= D34), N47 (= N35), F48 (≠ L36), T50 (= T38), G51 (= G39), D77 (= D54), I78 (≠ V55), Q97 (≠ L74), A99 (= A76), T116 (≠ S93), A139 (= A116), A140 (≠ S117), Y165 (= Y143), K169 (= K147), Y192 (≠ F170), N194 (= N172), V195 (≠ I173)
- binding uridine-5'-diphosphate-glucose: S141 (= S118), Y165 (= Y143), N194 (= N172), A208 (≠ G186), V209 (= V187), W213 (≠ F191), Y224 (≠ A202), I225 (≠ V203), N226 (≠ F204), L270 (= L247), R298 (= R270), D301 (= D273)
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
36% identity, 96% coverage: 7:301/307 of query aligns to 23:332/345 of Q7BJX9
- GVAGFI 26:31 (≠ GGAGFI 10:15) binding
- DNFSTG 50:55 (≠ DNLSTG 34:39) binding
- DI 81:82 (≠ DV 54:55) binding
- QAA 101:103 (≠ LAA 74:76) binding
- T120 (≠ S93) binding
- SS 145:146 (≠ SA 118:119) binding
- S147 (≠ A120) mutation to T: No effect on epimerase activity.
- Y169 (= Y143) binding
- K173 (= K147) binding
- YFN 196:198 (≠ FFN 170:172) binding
- V199 (≠ I173) binding
- VIPK 213:216 (≠ VISI 187:190) binding
- YIN 228:230 (≠ AVF 202:204) binding
- S236 (≠ T210) mutation to G: No effect on epimerase activity.
- R237 (= R211) binding
- R271 (≠ A244) mutation to G: No effect on epimerase activity.
- RSGD 302:305 (= RSGD 270:273) binding
- R307 (= R275) mutation to A: No effect on epimerase activity.
- H308 (= H276) mutation to A: No effect on epimerase activity.
- S309 (= S277) mutation to Y: Abolishes epimerase activity.
8vr2B Crystal structure of the pcryo_0617 oxidoreductase/decarboxylase from psychrobacter cryohalolentis k5 in the presence of NAD and udp
36% identity, 88% coverage: 5:274/307 of query aligns to 9:278/321 of 8vr2B
- binding nicotinamide-adenine-dinucleotide: G14 (= G10), G17 (= G13), F18 (= F14), I19 (= I15), D37 (= D34), N38 (= N35), E40 (≠ S37), R41 (≠ T38), N61 (≠ D54), V62 (= V55), A81 (≠ L74), A82 (= A75), A83 (= A76), F124 (≠ A116), K154 (= K147), P177 (≠ F170), N179 (= N172)
- binding uridine-5'-diphosphate: R147 (≠ P139), G189 (= G186), A190 (≠ V187), M194 (≠ F191), Y205 (≠ A202), I206 (≠ V203), F207 (= F204), R214 (= R211), I251 (≠ L247)
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
34% identity, 97% coverage: 6:303/307 of query aligns to 3:304/313 of 6bwlA
- active site: T122 (≠ S118), C123 (≠ A119), M124 (≠ A120), Y147 (= Y143), K151 (= K147)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), N35 (≠ T38), S36 (≠ G39), D57 (= D54), I58 (≠ V55), L79 (= L74), A80 (= A75), A81 (= A76), I83 (≠ A78), M120 (≠ A116), K151 (= K147), N176 (= N172), T177 (≠ I173)
- binding uridine-5'-diphosphate: N176 (= N172), G189 (= G186), V190 (= V187), N205 (≠ A202), I206 (≠ V203), Y207 (≠ F204), Q212 (= Q209), R214 (= R211), I250 (≠ L247), E275 (≠ D273)
6pnlA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
34% identity, 97% coverage: 6:303/307 of query aligns to 18:318/336 of 6pnlA
- active site: S133 (= S118), C135 (≠ A120), G136 (vs. gap), Y159 (= Y143), K163 (= K147)
- binding nicotinamide-adenine-dinucleotide: G22 (= G10), G25 (= G13), C26 (≠ F14), D46 (= D34), N47 (= N35), L48 (= L36), S49 (= S37), S50 (≠ T38), S51 (≠ G39), D68 (= D54), I69 (≠ V55), L89 (= L74), A91 (= A76), F93 (≠ A78), V108 (≠ S93), S131 (≠ A116), S133 (= S118), Y159 (= Y143), K163 (= K147), F186 (= F170), N188 (= N172), V189 (≠ I173), R200 (≠ S185)
- binding uridine-5'-diphosphate: N188 (= N172), N201 (≠ G186), V202 (= V187), F206 (= F191), P217 (≠ A202), I218 (≠ V203), T219 (≠ F204), R226 (= R211), V262 (≠ L250), R285 (= R270)
6pmhA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
34% identity, 97% coverage: 6:303/307 of query aligns to 12:312/330 of 6pmhA
- active site: S127 (= S118), C129 (≠ A120), G130 (vs. gap), Y153 (= Y143), K157 (= K147)
- binding adenosine monophosphate: G16 (= G10), G19 (= G13), D40 (= D34), N41 (= N35), S43 (= S37), S44 (≠ T38), S45 (≠ G39), D62 (= D54), I63 (≠ V55), A84 (= A75), F87 (≠ A78), R194 (≠ S185)
- binding uridine-5'-diphosphate: C129 (≠ A120), N182 (= N172), N195 (≠ G186), V196 (= V187), F200 (= F191), P211 (≠ A202), I212 (≠ V203), T213 (≠ F204), R220 (= R211), V256 (≠ L250), R279 (= R270)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
36% identity, 97% coverage: 7:305/307 of query aligns to 4:305/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (= I15), D31 (= D34), N32 (= N35), T35 (= T38), G36 (= G39), D56 (= D59), I57 (≠ C60), L77 (= L74), A78 (= A75), A79 (= A76), I81 (≠ A78), V96 (≠ S93), T119 (≠ A116), Y146 (= Y143), K150 (= K147), P173 (≠ F170), A174 (≠ F171), N175 (= N172), V176 (≠ I173)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A78), R84 (≠ Q81), S121 (= S118), G123 (vs. gap), Y146 (= Y143), A174 (≠ F171), N175 (= N172), A187 (≠ S185), G188 (= G186), V189 (= V187), F193 (= F191), R204 (≠ A202), V205 (= V203), F206 (= F204), R213 (= R211), D248 (≠ L247), R271 (= R270)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
36% identity, 97% coverage: 7:305/307 of query aligns to 4:305/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (= I15), D31 (= D34), N32 (= N35), T35 (= T38), G36 (= G39), D56 (= D59), I57 (≠ C60), L77 (= L74), A78 (= A75), A79 (= A76), I81 (≠ A78), T119 (≠ A116), Y146 (= Y143), K150 (= K147), P173 (≠ F170), N175 (= N172), V176 (≠ I173)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ A78), R84 (≠ Q81), S121 (= S118), G123 (vs. gap), S124 (≠ A120), Y146 (= Y143), A174 (≠ F171), N175 (= N172), G188 (= G186), V189 (= V187), F193 (= F191), R204 (≠ A202), V205 (= V203), F206 (= F204), N211 (≠ Q209), R213 (= R211), D248 (≠ L247), R271 (= R270)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
36% identity, 97% coverage: 7:305/307 of query aligns to 4:305/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ A78), R84 (≠ Q81), S121 (= S118), G123 (vs. gap), Y146 (= Y143), A174 (≠ F171), N175 (= N172), A187 (≠ S185), G188 (= G186), V189 (= V187), F193 (= F191), R204 (≠ A202), F206 (= F204), N211 (≠ Q209), R213 (= R211), D248 (≠ L247), R271 (= R270)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (= I15), D31 (= D34), N32 (= N35), A34 (≠ S37), T35 (= T38), G36 (= G39), D56 (= D59), I57 (≠ C60), L77 (= L74), A78 (= A75), A79 (= A76), I81 (≠ A78), T119 (≠ A116), Y146 (= Y143), K150 (= K147), P173 (≠ F170), A174 (≠ F171), V176 (≠ I173)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A78), R84 (≠ Q81), S121 (= S118), G123 (vs. gap), Y146 (= Y143), A174 (≠ F171), N175 (= N172), A187 (≠ S185), G188 (= G186), V189 (= V187), F193 (= F191), R204 (≠ A202), F206 (= F204), N211 (≠ Q209), R213 (= R211), D248 (≠ L247), R271 (= R270)
Q8NBZ7 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UGD; UXS-1; hUXS; hUXS1; EC 4.1.1.35 from Homo sapiens (Human) (see 4 papers)
33% identity, 97% coverage: 6:303/307 of query aligns to 91:386/420 of Q8NBZ7
- G98 (= G13) binding
- F99 (= F14) binding
- V100 (≠ I15) binding
- D119 (= D34) binding
- N120 (= N35) binding
- F122 (≠ S37) binding
- T123 (= T38) binding
- G124 (= G39) binding
- D144 (= D54) binding
- V145 (= V55) binding
- L149 (≠ D59) binding
- Y150 (≠ C60) binding
- L159 (= L74) binding
- S161 (≠ A76) binding
- K177 (≠ Q92) binding
- T178 (≠ S93) binding
- N185 (= N100) binding
- G188 (≠ E103) binding
- K191 (≠ R106) binding
- R192 (≠ E107) binding
- A200 (= A116) binding
- E204 (≠ A120) mutation to A: Reduced UDP-glucuronic acid decarboxylase activity.
- Y231 (= Y143) active site, Proton acceptor; binding ; mutation to F: Abolished UDP-glucuronic acid decarboxylase activity.
- K235 (= K147) binding
- R236 (≠ L148) mutation to H: Strongly reduced UDP-glucuronic acid decarboxylase activity, caused by a local unfolding of the active site that allows for a rotation of the dimer interface, leading to the formation of a homohexamer.
- Y245 (= Y157) binding
- Q248 (= Q160) binding
- E249 (≠ H161) binding
- T261 (≠ I173) binding
- H267 (≠ D179) binding
- R272 (≠ G186) binding
- R361 (≠ S277) mutation to Q: Strongly reduced UDP-glucuronic acid decarboxylase activity.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
2b69A Crystal structure of human udp-glucoronic acid decarboxylase
32% identity, 97% coverage: 6:303/307 of query aligns to 4:299/312 of 2b69A
- active site: T115 (≠ S118), S116 (≠ A119), E117 (≠ A120), Y144 (= Y143), K148 (= K147), R185 (≠ G186)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), F12 (= F14), V13 (≠ I15), D32 (= D34), N33 (= N35), T36 (= T38), G37 (= G39), D57 (= D59), V58 (≠ C60), L72 (= L74), A73 (= A75), S74 (≠ A76), A76 (= A78), T91 (≠ S93), T115 (≠ S118), Y144 (= Y143), K148 (= K147), I171 (≠ F170), N173 (= N172), R185 (≠ G186)
- binding uridine-5'-diphosphate: P61 (≠ R63), L62 (≠ A64), Y63 (≠ V65), P78 (≠ V80), N98 (= N100), G101 (≠ E103), L102 (≠ A104), K104 (≠ R106), R105 (≠ E107), Y158 (= Y157), N173 (= N172), R185 (≠ G186), V186 (= V187), N189 (≠ I190), T201 (≠ A202), Y203 (≠ F204), Q208 (= Q209), R210 (= R211), I244 (≠ L247), D270 (= D273)
Query Sequence
>GFF3507 FitnessBrowser__psRCH2:GFF3507
MVDAPILVTGGAGFIGSNLVDALLARGYAVRVLDNLSTGKRENLPQDVELIVGDVADADC
VRRAVQGCRAVVHLAAVASVQASVDDPIGTHQSNLVGTLNLCEAMREAGVKRVLFASSAA
VYGNNGEGQAIDEDTPKAPLTPYAADKLASEHYLDFYRRQHGLEPVVFRFFNIFGPRQDP
SSPYSGVISIFTERAQKGLPIAVFGDGEQTRDFVYVGDLVEVLVQALESPEAAEGAVNVG
LNQATSLNQLLEAIGDVLGGLPEVSYQASRSGDIRHSRANNARLVQRYRLPEPPTSMREG
LARLLGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory