Comparing GFF3510 FitnessBrowser__WCS417:GFF3510 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
35% identity, 95% coverage: 1:196/206 of query aligns to 2:199/201 of 3m3mA
4hz2B Crystal structure of glutathione s-transferase xaut_3756 (target efi- 507152) from xanthobacter autotrophicus py2
34% identity, 95% coverage: 2:197/206 of query aligns to 2:199/206 of 4hz2B
3wywB Structural characterization of catalytic site of a nilaparvata lugens delta-class glutathione transferase (see paper)
34% identity, 93% coverage: 2:193/206 of query aligns to 3:195/214 of 3wywB
8ai8A Crystal structure of glutathione transferase chi 1 from synechocystis sp. Pcc 6803 in complex with glutathione (see paper)
36% identity, 94% coverage: 1:193/206 of query aligns to 1:177/183 of 8ai8A
7pkaA Synechocystis sp. Pcc6803 glutathione transferase chi 1, gsoh bound
36% identity, 94% coverage: 1:193/206 of query aligns to 1:177/183 of 7pkaA
4gsnB Crystal structure of gste2 zan/u variant from anopheles gambiae (see paper)
34% identity, 92% coverage: 4:193/206 of query aligns to 5:195/220 of 4gsnB
2imkA Structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt- detoxifying activity (see paper)
33% identity, 92% coverage: 4:193/206 of query aligns to 5:195/220 of 2imkA
Sites not aligning to the query:
3zmkB Anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa (see paper)
31% identity, 92% coverage: 4:193/206 of query aligns to 8:198/222 of 3zmkB
5f06A Crystal structure of glutathione transferase f7 from populus trichocarpa (see paper)
32% identity, 94% coverage: 1:193/206 of query aligns to 1:204/213 of 5f06A
4ri6A Crystal structure of poplar glutathione transferase f1 (see paper)
30% identity, 83% coverage: 2:171/206 of query aligns to 4:173/214 of 4ri6A
4pnfB Glutathione s-transferase from drosophila melanogaster - isozyme e6 (see paper)
33% identity, 93% coverage: 2:193/206 of query aligns to 3:197/221 of 4pnfB
7rkaA Crystal structure analysis of colorado potato beetle glutathione-s transferase ldgstu1 (see paper)
33% identity, 80% coverage: 20:183/206 of query aligns to 20:185/211 of 7rkaA
5a5kA Atgstf2 from arabidopsis thaliana in complex with camalexin (see paper)
32% identity, 93% coverage: 2:192/206 of query aligns to 2:205/210 of 5a5kA
1gnwA Structure of glutathione s-transferase (see paper)
32% identity, 93% coverage: 2:192/206 of query aligns to 2:205/210 of 1gnwA
1bx9A Glutathione s-transferase in complex with herbicide (see paper)
32% identity, 93% coverage: 2:192/206 of query aligns to 2:205/210 of 1bx9A
5a4wA Atgstf2 from arabidopsis thaliana in complex with quercetrin (see paper)
32% identity, 93% coverage: 2:192/206 of query aligns to 3:206/211 of 5a4wA
5a4vA Atgstf2 from arabidopsis thaliana in complex with quercetin (see paper)
32% identity, 93% coverage: 2:192/206 of query aligns to 3:206/211 of 5a4vA
5a4uA Atgstf2 from arabidopsis thaliana in complex with indole-3-aldehyde (see paper)
32% identity, 93% coverage: 2:192/206 of query aligns to 3:206/211 of 5a4uA
7rhpA Crystal structure of honeybee (apis mellifera) glutathione s- transferase amgstd1 (see paper)
29% identity, 91% coverage: 2:188/206 of query aligns to 8:194/215 of 7rhpA
6zb6D Crystal structure of lolium rigidum gstf in complex with s-(p- nitrobenzyl) glutathione (see paper)
30% identity, 97% coverage: 2:201/206 of query aligns to 4:215/215 of 6zb6D
>GFF3510 FitnessBrowser__WCS417:GFF3510
MIKLYGFPLSGHSHRVELMLSLLGLPTEFVQVDLKQGAHKAPEFIASINPFGQVPAIDDN
GVVLADSNAILVYLANTYGNGQWLPSDPVGQARVQRWLSAAAGQLHAGPASARLATVFGA
EVDTAVAIARSHALLKLVEAQLSQSRFLVGEQPTIADVAFYTYTAHAPEGNVSLADYPQV
RAWLASIEALPGFVGMPRTAVGLQSQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory