SitesBLAST
Comparing GFF353 FitnessBrowser__psRCH2:GFF353 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5oasA Crystal structure of malate synthase g from pseudomonas aeruginosa in apo form. (see paper)
83% identity, 100% coverage: 1:726/726 of query aligns to 4:728/728 of 5oasA
5vfbA 1.36 angstrom resolution crystal structure of malate synthase g from pseudomonas aeruginosa in complex with glycolic acid.
82% identity, 100% coverage: 2:726/726 of query aligns to 1:724/724 of 5vfbA
P9WK16 Malate synthase G; EC 2.3.3.9 from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) (see paper)
67% identity, 100% coverage: 1:723/726 of query aligns to 1:724/741 of P9WK16
- R339 (= R341) active site, Proton acceptor
- D633 (= D632) active site, Proton donor
6axeA Crystal structure of a malate synthase g from mycobacterium marinum bound to acetyl coa
67% identity, 100% coverage: 1:725/726 of query aligns to 2:729/729 of 6axeA
- active site: D272 (= D272), E274 (= E274), R338 (= R341), E437 (= E433), D465 (= D461), D636 (= D632)
- binding acetyl coenzyme *a: V119 (= V118), V120 (= V119), R126 (= R125), F127 (= F126), N130 (= N129), A131 (= A130), R311 (= R313), R338 (= R341), M518 (= M514), W544 (= W540), P546 (= P542), P548 (= P544), C622 (= C618), K624 (= K620), M634 (= M630), D636 (= D632)
- binding magnesium ion: E437 (= E433), D465 (= D461)
2gq3A Mycobacterium tuberculosis malate synthase in complex with magnesium, malate, and coenzyme a (see paper)
67% identity, 99% coverage: 2:723/726 of query aligns to 1:717/720 of 2gq3A
- active site: D267 (= D272), E269 (= E274), R335 (= R341), E430 (= E433), D458 (= D461), D626 (= D632)
- binding coenzyme a: V114 (= V118), V115 (= V119), R121 (= R125), F122 (= F126), N125 (= N129), A126 (= A130), K301 (= K306), R308 (= R313), P539 (= P542), P541 (= P544), C612 (= C618), M624 (= M630), D626 (= D632)
- binding magnesium ion: H370 (= H376), K373 (≠ N379), N378 (= N381), G379 (≠ T382), L381 (≠ R384), E430 (= E433), D458 (= D461)
6dnpA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-3-methyl-6-f-phenyldiketoacid (see paper)
67% identity, 99% coverage: 2:723/726 of query aligns to 1:709/712 of 6dnpA
- active site: D270 (= D272), E272 (= E274), R328 (= R341), E419 (= E433), D447 (= D461), D618 (= D632)
- binding (2Z)-4-(2,6-difluoro-3-methylphenyl)-2-hydroxy-4-oxobut-2-enoic acid: R328 (= R341), E419 (= E433), G444 (= G458), L446 (= L460), D447 (= D461), M500 (= M514), W526 (= W540), M616 (= M630), D618 (= D632)
- binding magnesium ion: E419 (= E433), D447 (= D461)
5cbiA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-chloro-2-hydroxybenzonitrile (see paper)
66% identity, 99% coverage: 2:723/726 of query aligns to 1:716/719 of 5cbiA
- active site: D270 (= D272), E272 (= E274), R331 (= R341), E426 (= E433), D454 (= D461), D625 (= D632)
- binding 5-chloro-2-hydroxybenzonitrile: L53 (= L54), N54 (≠ A55), D57 (= D58), F125 (= F126), Y138 (= Y139), D139 (= D140), Y142 (= Y143), M507 (= M514), W533 (= W540), P535 (= P542), A611 (≠ C618), M623 (= M630), M623 (= M630), E624 (= E631), D625 (= D632)
- binding magnesium ion: E426 (= E433), D454 (= D461)
6bu1A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-3-oh-phenyldiketoacid (see paper)
66% identity, 99% coverage: 3:723/726 of query aligns to 1:709/712 of 6bu1A
- active site: D269 (= D272), E271 (= E274), R327 (= R341), E419 (= E433), D447 (= D461), D618 (= D632)
- binding (2Z)-4-(2-bromo-3-hydroxyphenyl)-2-hydroxy-4-oxobut-2-enoic acid: V116 (= V118), R327 (= R341), E419 (= E433), G444 (= G458), L446 (= L460), D447 (= D461), M500 (= M514), W526 (= W540), M616 (= M630), D618 (= D632)
- binding magnesium ion: E419 (= E433), D447 (= D461), V463 (= V477), R464 (= R478)
5cjmA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4h-thieno[3,2-b]pyrrole-5-carboxylic acid (see paper)
67% identity, 99% coverage: 2:723/726 of query aligns to 1:708/711 of 5cjmA
- active site: D270 (= D272), E272 (= E274), R328 (= R341), E418 (= E433), D446 (= D461), D617 (= D632)
- binding 4h-thieno[3,2-b]pyrole-5-carboxylic acid: V117 (= V118), S274 (= S276), M499 (= M514), E616 (= E631), D617 (= D632)
- binding magnesium ion: E418 (= E433), D446 (= D461)
6dkoA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,6-f-phenyldiketoacid (see paper)
66% identity, 99% coverage: 2:723/726 of query aligns to 1:713/716 of 6dkoA
- active site: D270 (= D272), E272 (= E274), R332 (= R341), E424 (= E433), D452 (= D461), D622 (= D632)
- binding 4-(2,6-difluorophenyl)-2,4-dioxobutanoic acid: R332 (= R341), G449 (= G458), L451 (= L460), D452 (= D461), M505 (= M514), W531 (= W540), M620 (= M630), D622 (= D632)
- binding magnesium ion: E424 (= E433), D452 (= D461)
5c9rA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-((4-chlorophenyl)thio)propanoic acid (see paper)
66% identity, 99% coverage: 2:723/726 of query aligns to 1:714/717 of 5c9rA
- active site: D270 (= D272), E272 (= E274), R331 (= R341), E424 (= E433), D452 (= D461), D623 (= D632)
- binding 3-[(4-chlorophenyl)sulfanyl]propanoic acid: V117 (= V118), E424 (= E433), D452 (= D461), M505 (= M514), W531 (= W540), M621 (= M630), D623 (= D632)
- binding magnesium ion: E424 (= E433), D452 (= D461)
6dl9A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,6-cl-phenyldiketoacid (see paper)
66% identity, 99% coverage: 2:723/726 of query aligns to 1:713/716 of 6dl9A
- active site: D270 (= D272), E272 (= E274), R328 (= R341), E423 (= E433), D451 (= D461), D622 (= D632)
- binding 4-(2,6-dichlorophenyl)-2,4-dioxobutanoic acid: V117 (= V118), R328 (= R341), E423 (= E433), G448 (= G458), L450 (= L460), D451 (= D461), M504 (= M514), W530 (= W540), M620 (= M630), D622 (= D632)
- binding magnesium ion: E423 (= E433), D451 (= D461)
5c9xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,4-dichloro-5-fluorobenzoic acid (see paper)
66% identity, 99% coverage: 2:723/726 of query aligns to 1:713/716 of 5c9xA
- active site: D270 (= D272), E272 (= E274), R328 (= R341), E423 (= E433), D451 (= D461), D622 (= D632)
- binding 2,4-dichloro-5-fluorobenzoic acid: V117 (= V118), S274 (= S276), R328 (= R341), M504 (= M514), W530 (= W540), M620 (= M630), D622 (= D632)
- binding magnesium ion: K295 (= K297), H363 (= H376), K366 (≠ N379), N371 (= N381), G372 (≠ T382), L374 (≠ R384), E423 (= E433), D451 (= D461)
5c7vA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 1h-pyrrole-2-carboxylic acid (see paper)
66% identity, 99% coverage: 2:723/726 of query aligns to 1:713/716 of 5c7vA
5cakA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-3-(1h-indol-3-yl)propanoic acid (see paper)
66% identity, 99% coverage: 2:723/726 of query aligns to 1:714/717 of 5cakA
- active site: D270 (= D272), E272 (= E274), R329 (= R341), E424 (= E433), D452 (= D461), D623 (= D632)
- binding (2R)-2-hydroxy-3-(1H-indol-3-yl)propanoic acid: V117 (= V118), L451 (= L460), M505 (= M514), E622 (= E631), D623 (= D632)
- binding magnesium ion: E424 (= E433), D452 (= D461)
5t8gA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-oxo-4-((thiophene-2-carbonyl)oxy)butanoic acid (see paper)
66% identity, 99% coverage: 2:723/726 of query aligns to 1:711/714 of 5t8gA
- active site: D270 (= D272), E272 (= E274), R328 (= R341), E421 (= E433), D449 (= D461), D620 (= D632)
- binding (3E)-2-oxo-4-[(thiophen-2-ylcarbonyl)oxy]but-3-enoic acid: V117 (= V118), R328 (= R341), E421 (= E433), G446 (= G458), L448 (= L460), D449 (= D461), M502 (= M514), W528 (= W540), E619 (= E631), D620 (= D632)
- binding magnesium ion: E421 (= E433), D449 (= D461), R466 (= R478), T469 (≠ A481)
5dx7A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-(5-chlorothiophen-2-yl)isoxazole-3-carboxylic acid (see paper)
66% identity, 99% coverage: 2:723/726 of query aligns to 1:711/714 of 5dx7A
- active site: D270 (= D272), E272 (= E274), R328 (= R341), E421 (= E433), D449 (= D461), D620 (= D632)
- binding 5-(5-chlorothiophen-2-yl)-1,2-oxazole-3-carboxylic acid: V117 (= V118), M502 (= M514), M618 (= M630), D620 (= D632)
- binding magnesium ion: E421 (= E433), D449 (= D461)
5c9uA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-(2-(2,4-dichlorophenyl)hydrazinyl)-2-oxoacetic acid (see paper)
66% identity, 99% coverage: 2:723/726 of query aligns to 1:711/714 of 5c9uA
- active site: D270 (= D272), E272 (= E274), R328 (= R341), E421 (= E433), D449 (= D461), D620 (= D632)
- binding [2-(2,4-dichlorophenyl)hydrazinyl](oxo)acetic acid: E421 (= E433), G446 (= G458), L448 (= L460), D449 (= D461), M502 (= M514), W528 (= W540), M618 (= M630), E619 (= E631), D620 (= D632)
- binding magnesium ion: E421 (= E433), D449 (= D461)
5drcA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-4-(1h-indol-3-yl)-4-oxobut-2-enoic acid (see paper)
66% identity, 99% coverage: 2:723/726 of query aligns to 1:713/716 of 5drcA
- active site: D270 (= D272), E272 (= E274), R330 (= R341), E423 (= E433), D451 (= D461), D622 (= D632)
- binding (2Z)-2-hydroxy-4-(1H-indol-3-yl)-4-oxobut-2-enoic acid: R330 (= R341), E423 (= E433), G448 (= G458), L450 (= L460), D451 (= D461), M504 (= M514), W530 (= W540), M620 (= M630), D622 (= D632)
- binding magnesium ion: E423 (= E433), D451 (= D461), R468 (= R478), T471 (≠ A481)
5cc3A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 6-bromo-1h-indole-2-carboxylic acid
66% identity, 99% coverage: 2:723/726 of query aligns to 1:712/715 of 5cc3A
- active site: D270 (= D272), E272 (= E274), R328 (= R341), E422 (= E433), D450 (= D461), D621 (= D632)
- binding 6-bromanyl-1H-indole-2-carboxylic acid: V117 (= V118), M503 (= M514), M619 (= M630), D621 (= D632)
- binding magnesium ion: E422 (= E433), D450 (= D461), V466 (= V477), R467 (= R478), T470 (≠ A481)
Query Sequence
>GFF353 FitnessBrowser__psRCH2:GFF353
MTERVQVGGLQVAKVLYDFVNNEAIPGTGVDAAAFWAGADSVIHDLAPKNRALLAKRDDL
QAQIDAWHQARAGQAHDAVAYKSFLQEIGYLLPEAEDFQATTENVDEEIARMAGPQLVVP
IMNARFALNAANARWGSLYDALYGTDAISEADGASKGPGYNEIRGNKVIAYARNFLNEAA
PLETGSHVDSTGYRIEGGKLVVSLKDGSTTGLKNPAQLQGFQGEASAPIAVLLKNNGIHF
EIQIDPASPIGQTDAAGVKDILMESALTTIMDCEDSIAAVDADDKTVVYRNWLGLMKGDL
VEELEKGGKRITRAMNPDRVYTKADGNGELTLHGRSLLFIRNVGHLMTNDAILDKEGNEV
PEGIMDGLFTSLIAVHNLNGNTSRKNTRTGSMYIVKPKMHGPEEVAFATELFGRVEDVLG
LPRNTLKVGIMDEERRTTINLKACIKEARERVVFINTGFLDRTGDEIHTSMEAGPMVRKA
AMKAEKWISAYENNNVDVGLACGLQGKAQIGKGMWAMPDLMAAMLEQKVGHPMAGANTAW
VPSPTAATLHAMHYHKIDVQARQVELAKREKASIDDILTIPLAQDTNWSEEEKRNELDNN
SQGILGYMVRWVEQGVGCSKVPDINDIALMEDRATLRISSQHVANWMRHGVVTKDQVVES
LKRMAPVVDRQNQGDPLYRPMAPDFDNSVAFQAALELVLEGTKQPNGYTEPVLHRRRREF
KAKNGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory