Comparing GFF3535 FitnessBrowser__WCS417:GFF3535 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P15028 Fe(3+) dicitrate-binding periplasmic protein FecB; Iron(III) dicitrate-binding periplasmic protein from Escherichia coli (strain K12) (see paper)
49% identity, 96% coverage: 3:297/306 of query aligns to 1:291/300 of P15028
3lhsA Open conformation of htsa complexed with staphyloferrin a (see paper)
37% identity, 90% coverage: 24:298/306 of query aligns to 1:288/291 of 3lhsA
3li2A Closed conformation of htsa complexed with staphyloferrin a (see paper)
37% identity, 90% coverage: 24:298/306 of query aligns to 1:288/288 of 3li2A
O31567 Probable siderophore-binding lipoprotein YfiY from Bacillus subtilis (strain 168) (see paper)
27% identity, 95% coverage: 3:292/306 of query aligns to 11:316/325 of O31567
3tnyA Structure of yfiy from bacillus cereus bound to the siderophore iron (iii) schizokinen
29% identity, 85% coverage: 33:292/306 of query aligns to 6:274/280 of 3tnyA
3mwfA Crystal structure of staphylococcus aureus sira complexed with staphyloferrin b
28% identity, 85% coverage: 33:292/306 of query aligns to 5:282/292 of 3mwfA
3gfvB Crystal structure of petrobactin-binding protein yclq from bacillu subtilis (see paper)
27% identity, 83% coverage: 33:286/306 of query aligns to 12:270/285 of 3gfvB
Sites not aligning to the query:
8b7xA X-ray structure of the ceue homologue from geobacillus stearothermophilus - apo form. (see paper)
25% identity, 80% coverage: 42:286/306 of query aligns to 17:263/276 of 8b7xA
Sites not aligning to the query:
8bawA X-ray structure of the ceue homologue from geobacillus stearothermophilus - 5-licam siderophore analogue complex. (see paper)
25% identity, 80% coverage: 42:286/306 of query aligns to 18:264/277 of 8bawA
8baxA X-ray structure of the ceue homologue from geobacillus stearothermophilus - azotochelin complex. (see paper)
25% identity, 80% coverage: 42:286/306 of query aligns to 22:268/281 of 8baxA
2chuA Ceue in complex with mecam (see paper)
24% identity, 79% coverage: 37:277/306 of query aligns to 22:260/283 of 2chuA
Sites not aligning to the query:
5ggxD Crystal structure of fe3+ - desferal bound siderophore binding protein fhud from vibrio cholerae
30% identity, 55% coverage: 44:210/306 of query aligns to 5:178/267 of 5ggxD
Sites not aligning to the query:
5a5vA A complex of the synthetic siderophore analogue fe(iii)-6-licam with the ceue periplasmic protein from campylobacter jejuni (see paper)
24% identity, 79% coverage: 37:277/306 of query aligns to 24:265/288 of 5a5vA
Sites not aligning to the query:
5od5A Periplasmic binding protein ceue complexed with a synthetic catalyst
23% identity, 79% coverage: 37:277/306 of query aligns to 23:265/288 of 5od5A
Sites not aligning to the query:
5oahA The periplasmic binding protein ceue of campylobacter jejuni binds the iron(iii) complex of azotochelin
23% identity, 79% coverage: 37:277/306 of query aligns to 23:265/288 of 5oahA
Sites not aligning to the query:
5a1jA Periplasmic binding protein ceue in complex with ferric 4-licam (see paper)
23% identity, 79% coverage: 37:277/306 of query aligns to 23:265/288 of 5a1jA
Sites not aligning to the query:
5advB The periplasmic binding protein ceue of campylobacter jejuni preferentially binds the iron(iii) complex of the linear dimer component of enterobactin (see paper)
23% identity, 79% coverage: 37:277/306 of query aligns to 22:264/287 of 5advB
Sites not aligning to the query:
5advA The periplasmic binding protein ceue of campylobacter jejuni preferentially binds the iron(iii) complex of the linear dimer component of enterobactin (see paper)
23% identity, 79% coverage: 37:277/306 of query aligns to 22:264/287 of 5advA
Sites not aligning to the query:
5a5dA A complex of the synthetic siderophore analogue fe(iii)-5-licam with the ceue periplasmic protein from campylobacter jejuni (see paper)
23% identity, 79% coverage: 37:277/306 of query aligns to 24:266/289 of 5a5dA
Sites not aligning to the query:
5ad1A A complex of the synthetic siderophore analogue fe(iii)-8-licam with the ceue periplasmic protein from campylobacter jejuni (see paper)
23% identity, 79% coverage: 37:277/306 of query aligns to 25:267/290 of 5ad1A
Sites not aligning to the query:
>GFF3535 FitnessBrowser__WCS417:GFF3535
MRMLRSIPTLAACVLAFSSSLLSAAPIDLNDGQHAVHLPDAPKRVVVLEFSFLDSLAAVD
VTPVGAADDGDANRVLPRVRQAIGQWKSVGLRSQPSIEEIARLKPDLIVADLNRHQALYS
DLASIAPTLLLPSRGEDYQGSLKSAELIGKALGKSAQMEARIQKNRENLNAIAQQIPAGA
SVLFGVAREDSFSVHGPDSYAGSVLEAIGLKVPSVRANAAPTEFVSLEQLLALDPGWLLV
GHYRRPSIVDSWSQQPLWQVLGAVRNKQVAEVDGDSWARNRGVLASEQIAEDALAILKGG
KAVLSQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory