Comparing GFF3543 PGA1_c35960 nitrogen regulatory protein PtsN to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
23% identity, 85% coverage: 2:132/154 of query aligns to 501:633/650 of O31645
Sites not aligning to the query:
1j6tA Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
30% identity, 65% coverage: 33:132/154 of query aligns to 28:128/144 of 1j6tA
P00550 PTS system mannitol-specific EIICBA component; EIICBA-Mtl; EII-Mtl; EC 2.7.1.197 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 65% coverage: 33:132/154 of query aligns to 520:620/637 of P00550
Sites not aligning to the query:
>GFF3543 PGA1_c35960 nitrogen regulatory protein PtsN
MQISNILKPEAVRVFGAASSKKRLFQEIADVAQLAYGLPAQPTVEALLDRESLGPTGVGH
GVALPHARLDGLDKVVGVFLVLDTPLEFGAVDRQPIDIAFALFAPEDAGVEHLKALALVS
RTLREQSFCTKLRANPDPATLHTILTEDQSVQAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory