SitesBLAST
Comparing GFF356 FitnessBrowser__psRCH2:GFF356 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
39% identity, 96% coverage: 3:248/255 of query aligns to 5:250/261 of P40288
- 11:35 (vs. 9:33, 44% identical) binding
- E96 (≠ Q94) mutation E->A,G,K: Heat stable.
- D108 (= D106) mutation to N: Heat stable.
- V112 (= V110) mutation to A: Heat stable.
- E133 (= E131) mutation to K: Heat stable.
- V183 (= V181) mutation to I: Heat stable.
- P194 (= P192) mutation to Q: Heat stable.
- E210 (≠ L208) mutation to K: Heat stable.
- Y217 (≠ R215) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
39% identity, 96% coverage: 3:248/255 of query aligns to 5:250/261 of 1g6kA
- active site: G18 (= G16), S145 (= S143), Y158 (= Y156), K162 (= K160)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ Q15), G18 (= G16), L19 (≠ I17), R39 (= R37), D65 (= D63), V66 (= V64), N92 (= N90), A93 (= A91), G94 (= G92), M143 (≠ N141), S145 (= S143), Y158 (= Y156), P188 (= P186), G189 (= G187), I191 (≠ V189), T193 (= T191)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
40% identity, 96% coverage: 3:248/255 of query aligns to 11:256/267 of 3ay6B
- active site: G24 (= G16), S151 (= S143), Y164 (= Y156), K168 (= K160)
- binding beta-D-glucopyranose: E102 (≠ Q94), S151 (= S143), H153 (= H145), W158 (≠ H150), Y164 (= Y156), N202 (= N194), K205 (≠ L197)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G12), T23 (≠ Q15), G24 (= G16), L25 (≠ I17), Y45 (≠ R37), D71 (= D63), V72 (= V64), N98 (= N90), A99 (= A91), G100 (= G92), V101 (= V93), M149 (≠ N141), S151 (= S143), Y164 (= Y156), K168 (= K160), P194 (= P186), G195 (= G187), M197 (≠ V189), T199 (= T191), P200 (= P192), I201 (= I193), N202 (= N194)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
41% identity, 98% coverage: 1:249/255 of query aligns to 1:246/247 of 4jroC
- active site: G16 (= G16), S142 (= S143), Q152 (≠ F153), Y155 (= Y156), K159 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ T14), R15 (≠ Q15), G16 (= G16), I17 (= I17), N35 (= N35), Y36 (≠ G36), N37 (≠ R37), G38 (≠ Q38), S39 (≠ D39), N63 (≠ D63), V64 (= V64), N90 (= N90), A91 (= A91), I93 (≠ V93), I113 (≠ V113), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), I188 (≠ V189), T190 (= T191)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
40% identity, 98% coverage: 3:251/255 of query aligns to 3:254/256 of 7do7A
- active site: G16 (= G16), S146 (= S143), Y159 (= Y156)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), R15 (≠ Q15), G16 (= G16), I17 (= I17), S37 (≠ R37), D66 (= D63), A67 (≠ V64), N93 (= N90), A94 (= A91), G95 (= G92), I96 (≠ V93), V144 (≠ N141), S145 (= S142), S146 (= S143), Y159 (= Y156), K163 (= K160), P189 (= P186), G190 (= G187), I192 (≠ V189), T194 (= T191), I196 (= I193)
- binding beta-L-rhamnopyranose: F99 (≠ H96), S146 (= S143), S148 (≠ H145), Q156 (≠ F153), Y159 (= Y156), N197 (= N194), D235 (≠ P232), M236 (≠ D233), R238 (≠ E235)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
40% identity, 98% coverage: 3:251/255 of query aligns to 3:254/256 of 7b81A
- active site: G16 (= G16), S146 (= S143), Y159 (= Y156)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), S14 (≠ T14), R15 (≠ Q15), I17 (= I17), D66 (= D63), A67 (≠ V64), N93 (= N90), A94 (= A91), G95 (= G92), I96 (≠ V93), T116 (≠ V113), V144 (≠ N141), S146 (= S143), Y159 (= Y156), K163 (= K160), P189 (= P186), G190 (= G187), I192 (≠ V189), T194 (= T191), I196 (= I193)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
42% identity, 97% coverage: 1:247/255 of query aligns to 1:242/248 of Q9KJF1
- M1 (= M1) modified: Initiator methionine, Removed
- S15 (≠ Q15) binding
- D36 (≠ R37) binding
- D62 (= D63) binding
- I63 (≠ V64) binding
- N89 (= N90) binding
- Y153 (= Y156) binding
- K157 (= K160) binding
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
42% identity, 96% coverage: 3:247/255 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), M16 (≠ I17), D35 (≠ R37), I36 (≠ Q38), I62 (≠ V64), N88 (= N90), G90 (= G92), I138 (≠ N141), S140 (= S143), Y152 (= Y156), K156 (= K160), I185 (≠ V189)
6oz7A Putative oxidoreductase from escherichia coli str. K-12
39% identity, 96% coverage: 6:249/255 of query aligns to 2:233/242 of 6oz7A
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
41% identity, 95% coverage: 8:248/255 of query aligns to 4:237/239 of 3sj7A
- active site: G12 (= G16), S138 (= S143), Q148 (≠ F153), Y151 (= Y156), K155 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (≠ T14), R11 (≠ Q15), I13 (= I17), N31 (= N35), Y32 (≠ G36), A33 (≠ R37), G34 (≠ Q38), S35 (≠ D39), A58 (= A62), N59 (≠ D63), V60 (= V64), N86 (= N90), A87 (= A91), T109 (≠ V113), S138 (= S143), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
40% identity, 95% coverage: 8:248/255 of query aligns to 7:244/246 of 3osuA
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
38% identity, 98% coverage: 3:251/255 of query aligns to 4:252/252 of 1vl8B
- active site: G17 (= G16), S143 (= S142), I154 (≠ F153), Y157 (= Y156), K161 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), R16 (≠ Q15), G17 (= G16), L18 (≠ I17), S37 (≠ G36), R38 (= R37), C63 (≠ A62), D64 (= D63), V65 (= V64), A91 (≠ N90), A92 (= A91), G93 (= G92), I94 (≠ V93), V114 (= V113), I141 (≠ N140), S143 (= S142), Y157 (= Y156), K161 (= K160), P187 (= P186), G188 (= G187), Y190 (≠ V189), T192 (= T191), M194 (≠ I193), T195 (≠ N194)
Q9BTZ2 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; NADPH-dependent retinol dehydrogenase/reductase; NRDR; humNRDR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; SCAD-SRL; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; Short-chain dehydrogenase/reductase family member 4; EC 1.1.1.184 from Homo sapiens (Human) (see 2 papers)
39% identity, 96% coverage: 3:247/255 of query aligns to 30:273/278 of Q9BTZ2
- S176 (≠ H150) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to F: Decreased reduction activity for benzil, isatin and retinal and increased activity for 5beta-Pregnane-3,20-dione and 5beta-Dihydrotestosterone. No change of stereoselectivity in 3-ketosteroids reduction and no change in 3beta-hydroxysteroid oxidation. Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with L-179. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with L-179. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with L-179. Loss of cold catalytic inactivation; when associated with L-179 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with L-179 and N-195.
- F179 (= F153) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to L: Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with F-176. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with F-176. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176. Loss of cold catalytic inactivation; when associated with F-176 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and N-195.
- T195 (≠ N169) mutation to N: Loss of cold catalytic inactivation. Loss of cold catalytic inactivation; when associated with F-176 and L-179. Switch in stereoselective activity from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176 and L-179. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and L-179.
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
38% identity, 97% coverage: 3:249/255 of query aligns to 8:245/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G12), D19 (≠ T14), L22 (≠ I17), I42 (≠ D40), D65 (= D63), M66 (≠ V64), N92 (= N90), A93 (= A91), G94 (= G92), L115 (≠ V113), I143 (≠ N141), S145 (= S143), Y158 (= Y156), K162 (= K160), G189 (= G187), M191 (≠ V189), T193 (= T191), N195 (= N199)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
41% identity, 97% coverage: 2:249/255 of query aligns to 4:243/244 of 4nbuB
- active site: G18 (= G16), N111 (= N114), S139 (= S143), Q149 (≠ F153), Y152 (= Y156), K156 (= K160)
- binding acetoacetyl-coenzyme a: D93 (≠ H96), K98 (≠ D101), S139 (= S143), N146 (≠ H150), V147 (≠ P151), Q149 (≠ F153), Y152 (= Y156), F184 (≠ A188), M189 (≠ I193), K200 (≠ L207)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ Q15), G18 (= G16), I19 (= I17), D38 (≠ R37), F39 (≠ Q38), V59 (≠ A62), D60 (= D63), V61 (= V64), N87 (= N90), A88 (= A91), G89 (= G92), I90 (≠ V93), T137 (≠ N141), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), F184 (≠ A188), T185 (≠ V189), T187 (= T191), M189 (≠ I193)
3o4rA Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
39% identity, 96% coverage: 3:247/255 of query aligns to 6:249/254 of 3o4rA
- active site: G19 (= G16), S145 (= S143), F155 (= F153), Y158 (= Y156), K162 (= K160), K203 (≠ P201)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A15 (≠ G12), T17 (= T14), D18 (≠ Q15), G19 (= G16), I20 (= I17), S39 (≠ G36), R40 (= R37), K41 (≠ Q38), N44 (≠ Q42), H65 (≠ D63), V66 (= V64), N92 (= N90), A94 (≠ G92), S145 (= S143), Y158 (= Y156), K162 (= K160), P188 (= P186), G189 (= G187), L190 (≠ A188), I191 (≠ V189), T193 (= T191), F195 (≠ I193), S196 (≠ N194)
7do6A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NADP bound-form) (see paper)
39% identity, 98% coverage: 3:251/255 of query aligns to 3:245/247 of 7do6A
- active site: G16 (= G16), S146 (= S143), Y159 (= Y156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ T14), R15 (≠ Q15), G16 (= G16), I17 (= I17), H36 (≠ G36), S37 (≠ R37), G42 (≠ Q42), D66 (= D63), A67 (≠ V64), N93 (= N90), A94 (= A91), G95 (= G92), I96 (≠ V93), T116 (≠ V113), S146 (= S143), Y159 (= Y156), K163 (= K160), I192 (≠ V189)
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
36% identity, 97% coverage: 5:251/255 of query aligns to 2:256/256 of Q48436
- 6:33 (vs. 9:37, 52% identical) binding
- D59 (= D63) binding
- K156 (= K160) binding
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
36% identity, 97% coverage: 5:251/255 of query aligns to 2:256/256 of 1gegE
- active site: G13 (= G16), S139 (= S143), Y152 (= Y156), K156 (= K160), V197 (≠ P201)
- binding alpha-D-glucopyranose: R63 (≠ V67), D64 (≠ E68), F67 (≠ Q71), E123 (≠ R127)
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), Q12 (= Q15), I14 (= I17), D33 (≠ R37), Y34 (≠ Q38), V58 (≠ A62), D59 (= D63), V60 (= V64), N86 (= N90), A87 (= A91), I109 (≠ V113), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), V185 (= V189), T187 (= T191), M189 (≠ I193)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
40% identity, 97% coverage: 1:248/255 of query aligns to 12:257/261 of 5u9pB
- active site: G27 (= G16), S152 (= S143), Y165 (= Y156), K169 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G12), R26 (≠ Q15), G27 (= G16), I28 (= I17), R48 (= R37), D73 (= D63), V74 (= V64), N100 (= N90), A101 (= A91), I150 (≠ N141), Y165 (= Y156), K169 (= K160), P195 (= P186), F198 (≠ V189), T200 (= T191), L202 (≠ I193), N203 (= N194)
Query Sequence
>GFF356 FitnessBrowser__psRCH2:GFF356
MRLQNQVALVTGSTQGIGRGIALRLAEEGADIVINGRQDDEQARESLEQVHARGRRVCFI
AADVGDVEQCQRLVREGIEQMGRLDILVNNAGVQRHAAFLDAQADDYDQVLNVNLRGPFF
LAQAFARYLREHGRGGRIINNSSVHEELPHPNFTAYCASKGGLKMLMRNIAIELAPLGIT
VNNVAPGAVETPINRELMNQPEKLASLLQNIPAGRLGRPHDVAGVVAFLASPDAEYITGT
TLVVDGGLLWNYSEQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory