SitesBLAST
Comparing GFF3574 FitnessBrowser__Phaeo:GFF3574 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ve5A Crystal structure of t.Th. Hb8 threonine deaminase
35% identity, 96% coverage: 5:306/314 of query aligns to 4:308/308 of 1ve5A
- active site: K50 (= K49), S56 (≠ N55), S72 (≠ G72), E200 (= E195), A204 (≠ S199), D206 (≠ A201), G229 (= G218), L299 (= L297), S300 (≠ C298)
- binding calcium ion: E200 (= E195), A204 (≠ S199), D206 (≠ A201)
- binding pyridoxal-5'-phosphate: F49 (= F48), K50 (= K49), N74 (= N74), G175 (vs. gap), G176 (vs. gap), G177 (vs. gap), G178 (vs. gap), E274 (= E270), T276 (≠ A272), S300 (≠ C298), G301 (= G299)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
30% identity, 95% coverage: 5:302/314 of query aligns to 22:327/339 of Q7XSN8
- E219 (= E195) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ A201) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
32% identity, 90% coverage: 19:302/314 of query aligns to 26:315/494 of 1tdjA
- active site: K58 (= K49), A83 (≠ G72), E209 (= E195), S213 (= S199), C215 (≠ A201), G237 (≠ A223), L310 (= L297), S311 (≠ C298)
- binding pyridoxal-5'-phosphate: F57 (= F48), K58 (= K49), N85 (= N74), G184 (vs. gap), G185 (≠ A171), G186 (≠ V172), G187 (= G173), G237 (≠ A223), E282 (= E270), S311 (≠ C298), G312 (= G299)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
32% identity, 90% coverage: 19:302/314 of query aligns to 30:319/514 of P04968
- K62 (= K49) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N74) binding
- GGGGL 188:192 (≠ -AVGG 171:174) binding
- S315 (≠ C298) binding
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
31% identity, 95% coverage: 6:302/314 of query aligns to 8:314/323 of 7nbfAAA
- active site: K53 (= K49), S81 (≠ G72), E207 (= E195), A211 (≠ S199), D213 (≠ A201), G236 (= G218), L309 (= L297), S310 (≠ C298)
- binding calcium ion: E207 (= E195), A211 (≠ S199), D213 (≠ A201)
- binding magnesium ion: N244 (≠ L232)
- binding pyridoxal-5'-phosphate: F52 (= F48), K53 (= K49), N83 (= N74), G182 (= G173), G183 (= G174), G184 (= G175), G185 (= G176), M186 (≠ L177), G236 (= G218), V237 (= V219), T282 (≠ A272), S310 (≠ C298), G311 (= G299)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ Q19), L22 (≠ R20), T23 (= T21), P24 (= P22), L26 (= L24), T27 (vs. gap), F46 (≠ M42)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
31% identity, 95% coverage: 6:302/314 of query aligns to 8:314/323 of 7nbdAAA
- active site: K53 (= K49), S81 (≠ G72), E207 (= E195), A211 (≠ S199), D213 (≠ A201), G236 (= G218), L309 (= L297), S310 (≠ C298)
- binding calcium ion: E207 (= E195), A211 (≠ S199), D213 (≠ A201)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (= W262), L278 (= L268), V314 (≠ I302)
- binding magnesium ion: N244 (≠ L232)
- binding pyridoxal-5'-phosphate: F52 (= F48), K53 (= K49), N83 (= N74), G182 (= G173), G183 (= G174), G184 (= G175), G185 (= G176), M186 (≠ L177), G236 (= G218), V237 (= V219), E280 (= E270), T282 (≠ A272), S310 (≠ C298), G311 (= G299)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
31% identity, 95% coverage: 6:302/314 of query aligns to 8:314/323 of 7nbcCCC
- active site: K53 (= K49), S81 (≠ G72), E207 (= E195), A211 (≠ S199), D213 (≠ A201), G236 (= G218), L309 (= L297), S310 (≠ C298)
- binding biphenyl-4-ylacetic acid: T78 (≠ A69), H79 (≠ A70), H84 (= H75), V148 (= V139), H149 (= H140), P150 (≠ A141)
- binding calcium ion: E207 (= E195), A211 (≠ S199), D213 (≠ A201)
- binding pyridoxal-5'-phosphate: F52 (= F48), K53 (= K49), N83 (= N74), G182 (= G173), G183 (= G174), G184 (= G175), G185 (= G176), M186 (≠ L177), G236 (= G218), V237 (= V219), T282 (≠ A272), S310 (≠ C298), G311 (= G299)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
31% identity, 95% coverage: 6:302/314 of query aligns to 8:314/323 of 7nbcAAA
- active site: K53 (= K49), S81 (≠ G72), E207 (= E195), A211 (≠ S199), D213 (≠ A201), G236 (= G218), L309 (= L297), S310 (≠ C298)
- binding calcium ion: E207 (= E195), A211 (≠ S199), D213 (≠ A201)
- binding magnesium ion: N244 (≠ L232)
- binding pyridoxal-5'-phosphate: F52 (= F48), K53 (= K49), N83 (= N74), G182 (= G173), G183 (= G174), G184 (= G175), G185 (= G176), M186 (≠ L177), G236 (= G218), V237 (= V219), T282 (≠ A272), S310 (≠ C298), G311 (= G299)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
31% identity, 95% coverage: 6:302/314 of query aligns to 8:314/322 of 7nbgAAA
- active site: K53 (= K49), S81 (≠ G72), E207 (= E195), A211 (≠ S199), D213 (≠ A201), G236 (= G218), L309 (= L297), S310 (≠ C298)
- binding calcium ion: E207 (= E195), A211 (≠ S199), D213 (≠ A201)
- binding pyridoxal-5'-phosphate: F52 (= F48), K53 (= K49), N83 (= N74), G182 (= G173), G183 (= G174), G184 (= G175), G185 (= G176), M186 (≠ L177), G236 (= G218), V237 (= V219), T282 (≠ A272), S310 (≠ C298), G311 (= G299)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ G72), G85 (= G76), Q86 (≠ A77), I101 (≠ V92), K111 (= K102), I115 (= I106), Y118 (≠ C109)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
31% identity, 95% coverage: 6:302/314 of query aligns to 8:314/320 of 7nbhAAA
- active site: K53 (= K49), S81 (≠ G72), E207 (= E195), A211 (≠ S199), D213 (≠ A201), G236 (= G218), L309 (= L297), S310 (≠ C298)
- binding calcium ion: E207 (= E195), A211 (≠ S199), D213 (≠ A201)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ G72), G85 (= G76), Q86 (≠ A77), K111 (= K102), I115 (= I106), Y118 (≠ C109), D235 (≠ S217), P281 (= P271), N313 (= N301), V314 (≠ I302)
Sites not aligning to the query:
6zspAAA serine racemase bound to atp and malonate. (see paper)
30% identity, 95% coverage: 6:302/314 of query aligns to 8:307/320 of 6zspAAA
- active site: K53 (= K49), S74 (≠ G72), E200 (= E195), A204 (≠ S199), D206 (≠ A201), G229 (= G218), L302 (= L297), S303 (≠ C298)
- binding adenosine-5'-triphosphate: S28 (vs. gap), S29 (vs. gap), I30 (vs. gap), K48 (≠ H44), T49 (= T45), Q79 (≠ A77), Y111 (≠ C109), E266 (≠ K263), R267 (≠ E264), K269 (≠ R266), N306 (= N301)
- binding magnesium ion: E200 (= E195), A204 (≠ S199), D206 (≠ A201)
- binding malonate ion: K53 (= K49), S73 (= S71), S74 (≠ G72), N76 (= N74), H77 (= H75), R125 (≠ A123), G229 (= G218), S232 (≠ A221)
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
30% identity, 95% coverage: 6:302/314 of query aligns to 9:310/322 of 3l6bA
- active site: K54 (= K49), S77 (≠ G72), E203 (= E195), A207 (≠ S199), D209 (≠ A201), G232 (= G218), T278 (≠ A272), L305 (= L297), S306 (≠ C298)
- binding malonate ion: K54 (= K49), S76 (= S71), S77 (≠ G72), N79 (= N74), H80 (= H75), R128 (≠ A123), G232 (= G218)
- binding manganese (ii) ion: E203 (= E195), A207 (≠ S199), D209 (≠ A201)
- binding pyridoxal-5'-phosphate: F53 (= F48), K54 (= K49), N79 (= N74), G178 (= G173), G179 (= G174), G180 (= G175), G181 (= G176), M182 (≠ L177), V233 (= V219), E276 (= E270), T278 (≠ A272), S306 (≠ C298), G307 (= G299)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
30% identity, 95% coverage: 6:302/314 of query aligns to 8:309/310 of 7nbgDDD
- active site: K53 (= K49), S76 (≠ G72), E202 (= E195), A206 (≠ S199), D208 (≠ A201), G231 (= G218), L304 (= L297), S305 (≠ C298)
- binding calcium ion: E202 (= E195), A206 (≠ S199), D208 (≠ A201)
- binding magnesium ion: N239 (≠ L232)
- binding ortho-xylene: S76 (≠ G72), Q81 (≠ A77), I96 (≠ V92), Y113 (≠ C109)
- binding pyridoxal-5'-phosphate: F52 (= F48), K53 (= K49), N78 (= N74), G177 (= G173), G178 (= G174), G179 (= G175), G180 (= G176), M181 (≠ L177), G231 (= G218), V232 (= V219), E275 (= E270), T277 (≠ A272), S305 (≠ C298), G306 (= G299)
Sites not aligning to the query:
5cvcA Structure of maize serine racemase (see paper)
30% identity, 94% coverage: 7:302/314 of query aligns to 8:311/329 of 5cvcA
- active site: K52 (= K49), S77 (≠ G72), E203 (= E195), A207 (≠ S199), D209 (≠ A201), G231 (≠ A223), V306 (≠ L297), S307 (≠ C298)
- binding magnesium ion: E203 (= E195), A207 (≠ S199), D209 (≠ A201)
- binding pyridoxal-5'-phosphate: F51 (= F48), K52 (= K49), N79 (= N74), S178 (≠ G173), G179 (= G174), G180 (= G175), G181 (= G176), L232 (= L224), E275 (= E270), S307 (≠ C298), G308 (= G299)
1ve5D Crystal structure of t.Th. Hb8 threonine deaminase
32% identity, 96% coverage: 5:306/314 of query aligns to 4:280/280 of 1ve5D
- active site: K50 (= K49), S56 (≠ N55), S72 (≠ G72), E172 (= E195), A176 (≠ S199), D178 (≠ A201), G201 (= G218), L271 (= L297), S272 (≠ C298)
- binding calcium ion: E172 (= E195), A176 (≠ S199), D178 (≠ A201)
- binding pyridoxal-5'-phosphate: F49 (= F48), K50 (= K49), N74 (= N74), G147 (vs. gap), G148 (vs. gap), G149 (vs. gap), G150 (vs. gap), V202 (= V219), E246 (= E270), T248 (≠ A272), S272 (≠ C298), G273 (= G299)
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
27% identity, 95% coverage: 6:302/314 of query aligns to 8:308/319 of 2zr8A
- active site: K53 (= K49), S78 (≠ G72), E204 (= E195), G208 (≠ S199), D210 (≠ A201), G232 (≠ A223), I303 (≠ L297), S304 (≠ C298)
- binding magnesium ion: E204 (= E195), G208 (≠ S199), D210 (≠ A201)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F48), K53 (= K49), S77 (= S71), S78 (≠ G72), N80 (= N74), H81 (= H75), P147 (≠ A141), G179 (= G173), G180 (= G174), G181 (= G175), G182 (= G176), G232 (≠ A223), E277 (= E270), T279 (≠ A272), S304 (≠ C298)
- binding serine: S78 (≠ G72), R129 (≠ L124), D231 (≠ N222), G232 (≠ A223), A233 (≠ L224), Q234 (≠ G225), T235 (≠ A226)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
27% identity, 95% coverage: 6:302/314 of query aligns to 8:308/319 of 2zpuA
- active site: K53 (= K49), S78 (≠ G72), E204 (= E195), G208 (≠ S199), D210 (≠ A201), G232 (≠ A223), I303 (≠ L297), S304 (≠ C298)
- binding magnesium ion: E204 (= E195), G208 (≠ S199), D210 (≠ A201)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F48), K53 (= K49), S77 (= S71), S78 (≠ G72), N80 (= N74), H81 (= H75), P147 (≠ A141), G179 (= G173), G180 (= G174), G181 (= G175), G182 (= G176), G232 (≠ A223), E277 (= E270), T279 (≠ A272), S304 (≠ C298)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 95% coverage: 6:302/314 of query aligns to 12:312/323 of O59791
- S82 (≠ G72) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
27% identity, 95% coverage: 6:302/314 of query aligns to 7:307/318 of 1wtcA
- active site: K52 (= K49), S77 (≠ G72), E203 (= E195), G207 (≠ S199), D209 (≠ A201), G231 (≠ A223), I302 (≠ L297), S303 (≠ C298)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ Q19), K47 (≠ H44), M48 (≠ T45), A109 (= A104), A110 (≠ L105), Y114 (≠ C109)
- binding magnesium ion: E203 (= E195), G207 (≠ S199), D209 (≠ A201)
- binding pyridoxal-5'-phosphate: F51 (= F48), K52 (= K49), N79 (= N74), G178 (= G173), G179 (= G174), G180 (= G175), G181 (= G176), G231 (≠ A223), E276 (= E270), T278 (≠ A272), S303 (≠ C298)
1v71A Crystal structure of s.Pombe serine racemase
27% identity, 95% coverage: 6:302/314 of query aligns to 7:307/318 of 1v71A
- active site: K52 (= K49), S77 (≠ G72), E203 (= E195), G207 (≠ S199), D209 (≠ A201), G231 (≠ A223), I302 (≠ L297), S303 (≠ C298)
- binding magnesium ion: E203 (= E195), G207 (≠ S199), D209 (≠ A201)
- binding pyridoxal-5'-phosphate: F51 (= F48), K52 (= K49), N79 (= N74), G178 (= G173), G179 (= G174), G180 (= G175), G181 (= G176), G231 (≠ A223), E276 (= E270), T278 (≠ A272), S303 (≠ C298), G304 (= G299)
Query Sequence
>GFF3574 FitnessBrowser__Phaeo:GFF3574
MHWTQDIRAADTRIRPYIQRTPILETTGFGLDYPISLKLEHMQHTGSFKARGAFNTLLGG
SVPDAGLVAASGGNHGAAVAYAAKRLGMRARVYVPEMAGPAKIALIRACGADLKVVPGAY
ANALEQAQAYEQQTGAMQVHAYDAAATVIGQGTCFAEWDAQGLEADTLLIAVGGGGLIAG
AMAWYGGSKKIVAVEPETSSALNAALAVGRPVDVEVSGVAANALGARRIGTLCYELAQGQ
SDTVTSLTVSDEAISAAQNKLWKERRLLVEPAGATALAALTSGAYQPAPDERVAVLLCGG
NIATDPLEALNVPS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory