Comparing GFF3576 FitnessBrowser__Phaeo:GFF3576 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
3tdtA Complex of tetrahydrodipicolinate n-succinyltransferase with 2-amino- 6-oxopimelate and coenzyme a (see paper)
64% identity, 98% coverage: 5:274/275 of query aligns to 3:271/274 of 3tdtA
2tdtA Complex of tetrahydrodipicolinate n-succinyltransferase with 2- aminopimelate and coenzyme a (see paper)
64% identity, 98% coverage: 5:274/275 of query aligns to 3:271/274 of 2tdtA
1kgtA Crystal structure of tetrahydrodipicolinate n-succinyltransferase in complex with pimelate and succinyl-coa (see paper)
64% identity, 98% coverage: 5:274/275 of query aligns to 3:271/274 of 1kgtA
1kgqA Crystal structure of tetrahydrodipicolinate n-succinyltransferase in complex with l-2-aminopimelate and succinamide-coa (see paper)
64% identity, 98% coverage: 5:274/275 of query aligns to 3:271/274 of 1kgqA
3r8yA Structure of the bacillus anthracis tetrahydropicolinate succinyltransferase
39% identity, 33% coverage: 108:198/275 of query aligns to 77:168/203 of 3r8yA
3bsyA Pgld from campylobacter jejuni, nctc 11168, in complex with acetyl coenzyme a (see paper)
26% identity, 58% coverage: 58:217/275 of query aligns to 23:191/193 of 3bsyA
3bssA Pgld from campylobacter jejuni, nctc 11168, with native substrate (see paper)
26% identity, 58% coverage: 58:217/275 of query aligns to 24:192/194 of 3bssA
Sites not aligning to the query:
2vheA Pgld-coa complex: an acetyl transferase from campylobacter jejuni (see paper)
26% identity, 58% coverage: 58:217/275 of query aligns to 24:192/194 of 2vheA
Sites not aligning to the query:
Q0P9D1 UDP-N-acetylbacillosamine N-acetyltransferase; Protein glycosylation D; UDP-4-amino-4,6-dideoxy-N-acetyl-alpha-D-glucosamine N-acetyltransferase; EC 2.3.1.203 from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) (see 2 papers)
26% identity, 58% coverage: 58:217/275 of query aligns to 25:193/195 of Q0P9D1
Sites not aligning to the query:
5tyhA Pgld from campylobacter jejuni nctc 11168 in complex with 5-(2- furanyl)-1h-pyrazole-3-carboxylic acid (see paper)
29% identity, 41% coverage: 104:217/275 of query aligns to 60:183/185 of 5tyhA
5t2yA Crystal structure of c. Jejuni pgld in complex with 5-methyl-4- (methylamino)-2-phenethylthieno[2,3-d]pyrimidine-6-carboxylic acid (see paper)
29% identity, 41% coverage: 104:217/275 of query aligns to 67:190/192 of 5t2yA
>GFF3576 FitnessBrowser__Phaeo:GFF3576
MSNAQLETAIEAAWEARDTITSATTGEQRDAIEETLNALDSGKLRVAERQDSGNWHVNQW
AKKAVLLGFRIKDMEEQSGGPQGSGWWDKVDSKFKGWGEAEWKEAGFRAVPNCVVRKSAY
IAPGVVLMPSFVNLGAHVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPT
IIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVPPYSVVVAG
SMPSKNGINLYCAVIVKRVDERTRSKTGINELLRD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory