Comparing GFF3587 FitnessBrowser__Phaeo:GFF3587 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
41% identity, 96% coverage: 10:378/385 of query aligns to 7:371/375 of 4pqaA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
41% identity, 96% coverage: 10:378/385 of query aligns to 7:371/376 of 4o23A
7lgpB Dape enzyme from shigella flexneri
40% identity, 96% coverage: 10:378/385 of query aligns to 9:372/377 of 7lgpB
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
38% identity, 95% coverage: 20:384/385 of query aligns to 17:377/377 of 7t1qA
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
36% identity, 97% coverage: 11:383/385 of query aligns to 8:376/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
36% identity, 97% coverage: 11:383/385 of query aligns to 12:380/380 of 5vo3A
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
42% identity, 45% coverage: 11:184/385 of query aligns to 10:182/258 of 4h2kA
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
28% identity, 97% coverage: 11:382/385 of query aligns to 13:382/383 of 7uoiA
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
38% identity, 45% coverage: 11:184/385 of query aligns to 8:180/265 of 4op4B
Sites not aligning to the query:
7rsfA Acetylornithine deacetylase from escherichia coli
27% identity, 81% coverage: 71:381/385 of query aligns to 76:377/380 of 7rsfA
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
25% identity, 94% coverage: 16:378/385 of query aligns to 22:394/407 of P37111
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
29% identity, 40% coverage: 62:216/385 of query aligns to 94:239/426 of 3pfoA
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
30% identity, 35% coverage: 71:204/385 of query aligns to 124:264/503 of Q8C165
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
26% identity, 64% coverage: 16:262/385 of query aligns to 22:276/408 of Q03154
Sites not aligning to the query:
1q7lA Zn-binding domain of the t347g mutant of human aminoacylase-i (see paper)
31% identity, 32% coverage: 16:139/385 of query aligns to 16:142/192 of 1q7lA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
36% identity, 28% coverage: 54:160/385 of query aligns to 114:217/507 of Q96KN2
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
36% identity, 28% coverage: 54:160/385 of query aligns to 83:186/471 of 3dljA
Sites not aligning to the query:
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
41% identity, 16% coverage: 54:116/385 of query aligns to 81:143/475 of Q96KP4
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
30% identity, 36% coverage: 65:201/385 of query aligns to 84:222/458 of 2pokA
Sites not aligning to the query:
2zogA Crystal structure of mouse carnosinase cn2 complexed with zn and bestatin (see paper)
38% identity, 16% coverage: 54:116/385 of query aligns to 85:147/478 of 2zogA
Sites not aligning to the query:
>GFF3587 FitnessBrowser__Phaeo:GFF3587
MTHSPLDPQQLTADLIRCASVTPEEGGALVLLDKVLSAAGFTCTRVDRGEVSNLIARWGD
KGHPRTMGFNGHTDVVPVGDTNAWTVDPFGAEEKDGFLYGRGATDMKSGVAAFVAAAIDL
VQTTPPDGAILLTITGDEEGDAIDGTTALLDHMDREGEQMAVCLVGEPTCPDKMGEMIKI
GRRGSLSAWFTVTGVQGHSAYPHRAKNPLNAMVRLMDRLASHELDQGTEHFDASTLAVVT
IDTGNPATNVIPAQTRSTVNIRFNDAHTGAELSDWLRAEAARAAKDFGVDIAVEIKVSGE
SFITPPGPLSDLVSAAVETETGRKPQLSTTGGTSDARFVKNHCPVVEVGLVGKTMHQVDE
RVEIAQIHQLKSIYGRILRDYFDQN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory